DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and dnajb12

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001015991.1 Gene:dnajb12 XenbaseID:XB-GENE-944288 Length:373 Species:Xenopus tropicalis

Alignment Length:108 Identity:50/109 (46%)
Similarity:69/109 (63%) Gaps:7/109 (6%)


  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKY 67
            ||||:|||:.:.||:|::||:||||||::|||||.|..|.:.||.:..||.|||:..||:.||::
 Frog   109 KDYYEILGVTREATEDDLKKSYRKLALKFHPDKNHAPGATEAFKAIGNAYAVLSNTEKRKQYDQF 173

  Fly    68 GEDGLKSGGTRNGGPSSNSFTYQFHGD--PRATFAQFFGNSNP 108
            ||:  |...:|:|   .:.|...|..|  |...|..|||...|
 Frog   174 GEE--KVSSSRHG---HSDFHRGFEADISPEDLFNMFFGGGFP 211

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 50/109 (46%)
DnaJ 4..65 CDD:278647 34/61 (56%)
DnaJ_C 174..338 CDD:199909
dnajb12NP_001015991.1 DnaJ 110..171 CDD:278647 34/61 (56%)
DUF1977 266..364 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117007616
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.