DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and Dnajb8

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_008761299.1 Gene:Dnajb8 RGDID:1561981 Length:235 Species:Rattus norvegicus

Alignment Length:235 Identity:76/236 (32%)
Similarity:110/236 (47%) Gaps:46/236 (19%)


  Fly     4 DYYKILGLPKTATDDEIKKAYRKLALRYHPDKN--KAANAEDKFKEVAEAYEVLSDKSKREVYDK 66
            :||::||:..:|:.::|||||||||||:|||||  ....||.|||:|:||||||||..||.|||:
  Rat     3 NYYEVLGVQSSASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKQVSEAYEVLSDSKKRSVYDR 67

  Fly    67 YGEDGLKSGG---TRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLD 128
            .|.||.::||   ..:.||....:.::   :|...|.:|||..:|| ||                
  Rat    68 AGCDGWRAGGGASVPHAGPFGAGYPFR---NPEDIFREFFGGLDPF-SF---------------- 112

  Fly   129 TEPDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVK 193
               :|:.:||...|..|||...|...|...                |...:.:.:.:.:.||...
  Rat   113 ---EFWDTPFSDRGRPHGLRGAFSSGFGEF----------------PAFMEAFSSFDTLGHGGGS 158

  Fly   194 KMKISRRIVQADGSSRKEEKFLAISIKPGWKSGTKVTFQK 233
            ....|.  ....||......|.::.......:|.|||.::
  Rat   159 HSTFSS--TSFGGSGSGSSGFKSVMSSTEMVNGRKVTTKR 196

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 76/236 (32%)
DnaJ 4..65 CDD:278647 39/63 (62%)
DnaJ_C 174..338 CDD:199909 11/61 (18%)
Dnajb8XP_008761299.1 DnaJ 3..66 CDD:278647 39/63 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117001485
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.