DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and Dnajb1

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_017456804.1 Gene:Dnajb1 RGDID:1304725 Length:376 Species:Rattus norvegicus

Alignment Length:294 Identity:162/295 (55%)
Similarity:204/295 (69%) Gaps:21/295 (7%)


  Fly     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYD 65
            ||||||:.|||.:.|:|||||:|||:.||||||||||...||:||||:||||:||||..|||::|
  Rat     1 MGKDYYQTLGLARGASDDEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFD 65

  Fly    66 KYGEDGLKSGGT---RNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDL 127
            :|||:|||.||.   .:||.:..||:|.|||||.|.||:|||..|||.:||...:.   ::..|:
  Rat    66 RYGEEGLKGGGPSGGSSGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNG---EEGMDI 127

  Fly   128 DTEPDFFSSPFGGIGSRHGLGSG-FRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGC 191
            |   |.|||...|:|....:..| .||:        ..|.:|  ||||||.|||.|:|||||.||
  Rat   128 D---DPFSSFPMGMGGFTNMNFGRSRPT--------QEPTRK--KQDPPVTHDLRVSLEEIYSGC 179

  Fly   192 VKKMKISRRIVQADGSS-RKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPH 255
            .||||||.:.:..||.| |.|:|.|.|.:|.|||.|||:||.|||||....|||||||:::||||
  Rat   180 TKKMKISHKRLNPDGKSIRNEDKILTIEVKRGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPH 244

  Fly   256 AMFKREGSDLRYTARLTLKQALCGVVFQVPTMSG 289
            .:|||:|||:.|.||::|::||||....|||:.|
  Rat   245 NIFKRDGSDVIYPARISLREALCGCTVNVPTLDG 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 162/295 (55%)
DnaJ 4..65 CDD:278647 42/61 (69%)
DnaJ_C 174..338 CDD:199909 71/118 (60%)
Dnajb1XP_017456804.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116604499
eggNOG 1 0.900 E1_COG0484
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 371 1.000 Inparanoid score I2028
OMA 1 1.010
OrthoDB 1 1.010 D1393097at2759
OrthoFinder 1 1.000 FOG0000281
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126773
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
TreeFam 1 0.960
109.670

Return to query results.
Submit another query.