DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and dnj-13

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_496468.1 Gene:dnj-13 WormBaseID:WBGene00001031 Length:331 Species:Caenorhabditis elegans

Alignment Length:352 Identity:173/353 (49%)
Similarity:232/353 (66%) Gaps:31/353 (9%)


  Fly     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYD 65
            |||||||:||:.|.||||||||||||:||:|||||||.|.||:||||:||||:||||..|:::||
 Worm     1 MGKDYYKVLGISKGATDDEIKKAYRKMALKYHPDKNKEAGAENKFKEIAEAYDVLSDDKKKKIYD 65

  Fly    66 KYGEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFAS----FFDMGDNLFDKKVFD 126
            ::||:|||.||...||.......|:|.|||...|:.|||.|:||.:    .||:|...       
 Worm    66 QFGEEGLKEGGPGAGGGGGGGMHYEFRGDPMNIFSSFFGGSDPFGAGGPGMFDLGGGA------- 123

  Fly   127 LDTEPDFFSSPFGGI--GSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYH 189
              ..|:.|....||:  |...|:..|.|   |.|:           :|||.|.|||.|:||::..
 Worm   124 --GGPNMFFMNQGGMDDGMFGGMHQGGR---RGHA-----------RQDPAVLHDLSVSLEDVLK 172

  Fly   190 GCVKKMKISRRIVQADGSSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKP 254
            |..|||||:|: |..|.:.|.|:|.|.::||||||||||:||.|||||.|.:.||||||:|:|||
 Worm   173 GTTKKMKITRK-VMTDNAQRLEDKVLTVTIKPGWKSGTKITFPKEGDQHPNRTPADIVFVIKDKP 236

  Fly   255 HAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKD 319
            |..|||||||::...:::||.||.|:...:||:.|...|:. :.::|||.|.:|:.|.|||.||.
 Worm   237 HPKFKREGSDIKRVEKISLKSALTGLDIMIPTLDGADYRLQ-LNDVIKPGTTRRLTGKGLPNPKS 300

  Fly   320 TTRKGDLLVAFDIQFPEKLTAAQKEVL 346
            .:.:|||::.||::||.:|...|:||:
 Worm   301 PSHRGDLIIEFDVEFPSQLNPTQREVI 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 173/353 (49%)
DnaJ 4..65 CDD:278647 45/61 (74%)
DnaJ_C 174..338 CDD:199909 84/164 (51%)
dnj-13NP_496468.1 DnaJ 1..331 CDD:223560 173/353 (49%)
DnaJ 4..65 CDD:278647 45/61 (74%)
DnaJ_C 159..319 CDD:199909 83/162 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116782745
eggNOG 1 0.900 E1_COG0484
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 369 1.000 Inparanoid score I1231
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1393097at2759
OrthoFinder 1 1.000 FOG0000281
OrthoInspector 1 1.000 T375225
orthoMCL 1 0.900 OOG5_126773
Panther 1 1.100 LDO PTHR24078
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1020
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.