DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and dnajb1b

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_956067.1 Gene:dnajb1b ZFINID:ZDB-GENE-030131-5455 Length:337 Species:Danio rerio

Alignment Length:351 Identity:176/352 (50%)
Similarity:248/352 (70%) Gaps:18/352 (5%)


  Fly     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYD 65
            ||||||.:||:.|.|:||||||||||.||:|||||||:|.||:||||:||||:||||..|:::||
Zfish     1 MGKDYYSVLGIQKGASDDEIKKAYRKQALKYHPDKNKSAGAEEKFKEIAEAYDVLSDPKKKDIYD 65

  Fly    66 KYGEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTE 130
            ::||:||| ||...||....::||.|.|||.|.|::|||..|||...|.....:.:    :::|:
Zfish    66 RFGEEGLK-GGAPGGGGGGGNYTYTFQGDPHAMFSEFFGGRNPFEHIFGHNGGMDE----NMETD 125

  Fly   131 PDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKM 195
            ..|.|...||||       ||..||.:||..    .:.|:||||.|.|||.|:|:|::.||.|||
Zfish   126 DLFASFGMGGIG-------GFPRSFTTHSHG----GRMERKQDPAVIHDLRVSLDEVFTGCTKKM 179

  Fly   196 KISRRIVQADG-SSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMFK 259
            ||||:.:..|| ::|.|:|.|.:.:|.|||.|||:||.:|||:.|..||||:||:::||||.::|
Zfish   180 KISRKRLNPDGRTTRSEDKILTVEVKKGWKEGTKITFPREGDETPSNIPADVVFVLKDKPHPVYK 244

  Fly   260 REGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDTTRKG 324
            |:|||:.|.|::|||:||||.|..|||:.|..::: |.|:|::|...:|:.|.|||.||...|:|
Zfish   245 RDGSDIIYPAKITLKEALCGCVINVPTLDGRTVKV-TSQDIVRPGMKRRLTGEGLPLPKSPDRRG 308

  Fly   325 DLLVAFDIQFPEKLTAAQKEVLKDML 350
            ||:|.::::|||||:...|:.:.::|
Zfish   309 DLVVEYEVRFPEKLSQNAKDTIANVL 334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 175/347 (50%)
DnaJ 4..65 CDD:278647 43/61 (70%)
DnaJ_C 174..338 CDD:199909 85/165 (52%)
dnajb1bNP_956067.1 DnaJ 1..328 CDD:223560 175/344 (51%)
DnaJ 4..65 CDD:278647 43/61 (70%)
DnaJ_C 160..322 CDD:199909 84/163 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116781880
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1393097at2759
OrthoFinder 1 1.000 FOG0000281
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126773
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.