DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and CG2887

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_572633.1 Gene:CG2887 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster

Alignment Length:378 Identity:151/379 (40%)
Similarity:212/379 (56%) Gaps:71/379 (19%)


  Fly     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYD 65
            |.||||||||:.:||.|.||:|||.|.||||||||||:..||:.||:||:||||||||.||..||
  Fly     1 MPKDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAKAYEVLSDKKKRGSYD 65

  Fly    66 KYGEDGLK--------------------------SGGTRNGGPSSNSFTYQFHGDPRATFAQFFG 104
            ...:.|.:                          |||...||..:|         |||.|.:||.
  Fly    66 SRNDKGTRRNTANQGSGFGDGTAFGSCGGGSGSGSGGGSGGGRQNN---------PRANFGRFFD 121

  Fly   105 NSNPFASFFDMGDNLFDKKVFDLDTEPDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKE 169
            ||..:::||:..:|       |.|::.|....  ||.|:                     |.::.
  Fly   122 NSESYSTFFEDIEN-------DFDSDDDVLLG--GGAGA---------------------PKRRC 156

  Fly   170 QKQDP--PVEHDLYVTLEEIYHGCVKKMKISRRIVQADGSSRKEEKFLAISIKPGWKSGTKVTFQ 232
            ::|.|  .:||.:||.||:|.:||.::|||||...:......:.::.|.:.|.||.|:|||:.|.
  Fly   157 EQQSPQSSIEHVIYVALEDIANGCNRRMKISRASGRNGVDGVQYDRILTVKIPPGCKAGTKICFP 221

  Fly   233 KEGDQAPGKIPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRIST- 296
            .||.|.|...||::|||||||||.:|:|:|::|.|||.::||.||||:...|||:.|..:.:.| 
  Fly   222 NEGIQLPNLEPANVVFIIRDKPHPIFRRDGNNLLYTAEISLKDALCGLHVMVPTLLGRPMELKTD 286

  Fly   297 MQEIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKDM 349
            :.|:|.|.:|:||.|||||...:.:|:|.::|.|.||||:   |..||:...:
  Fly   287 VGEVISPKSVRRILGYGLPDSINNSRRGSIVVRFSIQFPD---AISKELASSL 336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 151/375 (40%)
DnaJ 4..65 CDD:278647 43/61 (70%)
DnaJ_C 174..338 CDD:199909 76/167 (46%)
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 150/372 (40%)
DnaJ 4..65 CDD:278647 43/61 (70%)
DnaJ_C 163..326 CDD:199909 75/163 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134405989
eggNOG 1 0.900 E1_COG0484
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I844
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1393097at2759
OrthoFinder 1 1.000 FOG0000281
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24078
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.