DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and Dnajb4

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001013094.1 Gene:Dnajb4 RGDID:1305826 Length:337 Species:Rattus norvegicus

Alignment Length:358 Identity:190/359 (53%)
Similarity:246/359 (69%) Gaps:32/359 (9%)


  Fly     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYD 65
            ||||||.|||:.|.|||::|||||||.||::||||||:..||:||||||||||||||..|||:||
  Rat     1 MGKDYYHILGIEKGATDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYD 65

  Fly    66 KYGEDGLK--SGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFD--MGDNLFDKKVFD 126
            ::||:|||  :|||...|   .:|.|.|||||.||||.|||.:|||..||.  ||... |.:..:
  Rat    66 QFGEEGLKGGAGGTDGQG---GTFRYTFHGDPHATFAAFFGGANPFEIFFGRRMGGGR-DSEEME 126

  Fly   127 LDTEPDFFSSPFGGIG---SRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIY 188
            :|.:| |.:..|...|   .|:.:|    ||              ..|||||:.|:|.|:|||||
  Rat   127 IDGDP-FSAFGFSMNGYPRDRNSVG----PS--------------RLKQDPPIIHELKVSLEEIY 172

  Fly   189 HGCVKKMKISRRIVQADGSS-RKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRD 252
            .||.|:|||||:.:..||.| |.|:|.|.|.||.|||.|||:||.:|||:.|..|||||||||:|
  Rat   173 SGCTKRMKISRKRLNPDGRSYRSEDKILTIEIKKGWKEGTKITFPREGDETPNSIPADIVFIIKD 237

  Fly   253 KPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFP 317
            |.|..|||:||::.|||:::|::||||....||||.|..:.:| :.:|:||...:||.|||||||
  Rat   238 KEHPKFKRDGSNIVYTAKISLREALCGCSINVPTMDGRNIPMS-VTDIVKPGMRRRIIGYGLPFP 301

  Fly   318 KDTTRKGDLLVAFDIQFPEKLTAAQKEVLKDML 350
            |:..::||||:.||:.||:.::||.||:|:..|
  Rat   302 KNPDQRGDLLIEFDVSFPDVISAASKEILRKHL 334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 189/354 (53%)
DnaJ 4..65 CDD:278647 45/61 (74%)
DnaJ_C 174..338 CDD:199909 92/165 (56%)
Dnajb4NP_001013094.1 DnaJ 1..332 CDD:223560 189/355 (53%)
DnaJ 4..65 CDD:278647 45/61 (74%)
DnaJ_C 158..320 CDD:199909 92/163 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 371 1.000 Inparanoid score I2028
OMA 1 1.010
OrthoDB 1 1.010 D1393097at2759
OrthoFinder 1 1.000 FOG0000281
OrthoInspector 1 1.000 T131198
orthoMCL 1 0.900 OOG5_126773
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
TreeFam 1 0.960
109.740

Return to query results.
Submit another query.