DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and psi1

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_588477.1 Gene:psi1 PomBaseID:SPCC830.07c Length:379 Species:Schizosaccharomyces pombe

Alignment Length:384 Identity:145/385 (38%)
Similarity:204/385 (53%) Gaps:64/385 (17%)


  Fly     6 YKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKY--- 67
            |..|.:...|::.|:|||||||||:||||||  .|.|.||||::.|||||||..:|::||:|   
pombe     8 YDCLEVRPEASEAELKKAYRKLALKYHPDKN--PNGEKKFKEISLAYEVLSDPQRRKLYDQYGIT 70

  Fly    68 ------------GEDGLKSGGTRNGGPSSNSFTYQFH-GDPRATFAQFFGNSNP----------- 108
                        |..|...||....|| ..:.|:.|: |.|..  ||||..|:|           
pombe    71 EGNAAPPPPGAEGGPGAGFGGFPGAGP-GGARTFHFNMGGPGG--AQFFSASDPNDIFERVFGHA 132

  Fly   109 FASFFDMGDNLFDKKVFDLDTEPDFFSSPFGGIGSR---HGLGSGFRPSFRS-----HSFNVHTP 165
            ||....||..:......|.|.:.|      ||.|:|   .|:..||...|..     |:...|..
pombe   133 FAGGGGMGGGMGGMGGMDDDMDMD------GGFGTRTRGGGMPGGFANMFGGGGAGPHARRSHPS 191

  Fly   166 FKKEQKQDPPVEHD-----LYVTLEEIYHGCVKKMKISRRIVQADGSSRKEEKFLAISIKPGWKS 225
            |...:...||.:::     |.|:||:::.||.|||||||.|:.|.|.|.|.::.|.|.:|||||:
pombe   192 FGGSRPSQPPAQNEVITRPLNVSLEDLFTGCTKKMKISRHIIDASGQSVKADRILEIKVKPGWKA 256

  Fly   226 GTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGD 290
            |||:.|..|||:.|.....||.|::.:|||.:|.|.|.|||....|:||:||.|...|:.|:.|.
pombe   257 GTKIKFAGEGDEKPDGTVQDIQFVLAEKPHPVFTRSGDDLRMQVELSLKEALLGFSKQISTIDGK 321

  Fly   291 KLRISTM------QEIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQK 343
            ||::|:.      .||..|       |:|:|.||:.:::|::::...::||.:||.|||
pombe   322 KLKVSSSLPTQPGYEITYP-------GFGMPLPKNPSQRGNMIIECKVKFPTELTPAQK 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 145/385 (38%)
DnaJ 4..65 CDD:278647 34/59 (58%)
DnaJ_C 174..338 CDD:199909 70/175 (40%)
psi1NP_588477.1 DnaJ 2..379 CDD:223560 145/385 (38%)
DnaJ 7..65 CDD:278647 34/59 (58%)
DnaJ_C 207..368 CDD:199909 68/168 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 230 1.000 Inparanoid score I847
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000281
OrthoInspector 1 1.000 T631524
orthoMCL 1 0.900 OOG5_126773
Panther 1 1.100 O PTHR24078
Phylome 1 0.910 0.977 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1020
TreeFam 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.