DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and dnj-26

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_502326.1 Gene:dnj-26 WormBaseID:WBGene00001044 Length:365 Species:Caenorhabditis elegans

Alignment Length:264 Identity:61/265 (23%)
Similarity:95/265 (36%) Gaps:81/265 (31%)


  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYD-- 65
            ||:||||.:.|.|:.|||:.|:||.....||||.|..:|.:..|.|..|:.:|.|.:||..||  
 Worm    26 KDFYKILNVDKKASPDEIRIAFRKRIREVHPDKCKHPSATEASKVVNNAFSLLMDPAKRRQYDLQ 90

  Fly    66 ----------------------KYG-------EDGLKSGGTRNGGPSS-----NSFTYQFHGDPR 96
                                  :|.       :....|.|.||...||     ||..:|.:....
 Worm    91 NAETSNENLYKRCNRNKNQRKQEYSNTQRQNHKKSEPSNGKRNEQNSSFKQDHNSKNHQSNHQKT 155

  Fly    97 ATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFFSSPFGGIGSRHGLGSGFRPSFRSHSFN 161
            ..     ..|||:::     .|.|:....|...|...||   ...||..........:::|:.  
 Worm   156 KN-----KKSNPYSN-----QNNFNNTRKDYREEKSGFS---WNTGSADDYEDFVYRNYQSYQ-- 205

  Fly   162 VHTPFKKEQKQDPPVEHDLYV-------------TLEEIYHGCVKKMKISRRIVQADGSSRKEEK 213
                 :::|.|.....|:.|.             |..|.:|.            ::..|..::|:
 Worm   206 -----QQQQNQYARRRHEEYTDGFKYSSSSNPHSTSNEPFHD------------KSHNSDVEKEE 253

  Fly   214 FLAI 217
            :|.:
 Worm   254 YLVV 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 61/265 (23%)
DnaJ 4..65 CDD:278647 27/61 (44%)
DnaJ_C 174..338 CDD:199909 8/58 (14%)
dnj-26NP_502326.1 DnaJ 27..88 CDD:278647 27/61 (44%)
NST1 91..>194 CDD:290656 21/116 (18%)
MIG-14_Wnt-bd <255..365 CDD:284153 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.