DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and DNAJB8

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_699161.1 Gene:DNAJB8 HGNCID:23699 Length:232 Species:Homo sapiens

Alignment Length:187 Identity:75/188 (40%)
Similarity:99/188 (53%) Gaps:49/188 (26%)


  Fly     4 DYYKILGLPKTATDDEIKKAYRKLALRYHPDKN--KAANAEDKFKEVAEAYEVLSDKSKREVYDK 66
            :||::||:..:|:.::|||||||||||:|||||  ....||.|||.|:||||||||..||.:||:
Human     3 NYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSDSKKRSLYDR 67

  Fly    67 YGEDGLKSGG---TRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLD 128
            .|.|..::||   |....|....:|::   :|...|.:|||..:|| ||                
Human    68 AGCDSWRAGGGASTPYHSPFDTGYTFR---NPEDIFREFFGGLDPF-SF---------------- 112

  Fly   129 TEPDFFSSPF----GGIGSRHGL------GSGFRPSFRS--HSFNV-------HTPF 166
               :|:.|||    ||.|  |||      |.|..|:|..  .|||:       ||.|
Human   113 ---EFWDSPFNSDRGGRG--HGLRGAFSAGFGEFPAFMEAFSSFNMLGCSGGSHTTF 164

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 75/188 (40%)
DnaJ 4..65 CDD:278647 38/63 (60%)
DnaJ_C 174..338 CDD:199909
DNAJB8NP_699161.1 DnaJ 3..>106 CDD:223560 51/106 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117001476
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.