DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and DNAJB4

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001304028.1 Gene:DNAJB4 HGNCID:14886 Length:337 Species:Homo sapiens

Alignment Length:358 Identity:189/359 (53%)
Similarity:247/359 (69%) Gaps:32/359 (9%)


  Fly     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYD 65
            ||||||.|||:.|.|:|::|||||||.||::||||||:..||:||||||||||||||..|||:||
Human     1 MGKDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYD 65

  Fly    66 KYGEDGLK--SGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFD--MGDNLFDKKVFD 126
            ::||:|||  :|||...|   .:|.|.|||||.||||.|||.||||..||.  ||... |.:..:
Human    66 QFGEEGLKGGAGGTDGQG---GTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGR-DSEEME 126

  Fly   127 LDTEPDFFSSPFGGIG---SRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIY 188
            :|.:| |.:..|...|   .|:.:|    ||              ..||||||.|:|.|:|||||
Human   127 IDGDP-FSAFGFSMNGYPRDRNSVG----PS--------------RLKQDPPVIHELRVSLEEIY 172

  Fly   189 HGCVKKMKISRRIVQADGSS-RKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRD 252
            .||.|:|||||:.:.|||.| |.|:|.|.|.||.|||.|||:||.:|||:.|..|||||||||:|
Human   173 SGCTKRMKISRKRLNADGRSYRSEDKILTIEIKKGWKEGTKITFPREGDETPNSIPADIVFIIKD 237

  Fly   253 KPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFP 317
            |.|..|||:||::.|||:::|::||||....|||:.|..:.:| :.:|:||...:||.|||||||
Human   238 KDHPKFKRDGSNIIYTAKISLREALCGCSINVPTLDGRNIPMS-VNDIVKPGMRRRIIGYGLPFP 301

  Fly   318 KDTTRKGDLLVAFDIQFPEKLTAAQKEVLKDML 350
            |:..::||||:.|::.||:.::::.||||:..|
Human   302 KNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHL 334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 188/354 (53%)
DnaJ 4..65 CDD:278647 44/61 (72%)
DnaJ_C 174..338 CDD:199909 92/165 (56%)
DNAJB4NP_001304028.1 DnaJ 1..332 CDD:223560 188/355 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 371 1.000 Inparanoid score I2100
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1393097at2759
OrthoFinder 1 1.000 FOG0000281
OrthoInspector 1 1.000 T130177
orthoMCL 1 0.900 OOG5_126773
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1020
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.770

Return to query results.
Submit another query.