DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and dnajc22

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001107370.1 Gene:dnajc22 XenbaseID:XB-GENE-5859098 Length:340 Species:Xenopus tropicalis

Alignment Length:58 Identity:23/59 (39%)
Similarity:34/59 (58%) Gaps:4/59 (7%)


  Fly     7 KILGLPKTATDDEIKKAYRKLALRYHPDKN--KAANAEDKFKEVAEAYEVLS--DKSK 60
            |:||:...:|.:||.:.||:|...:|||.|  :...|::.|.|:..|||.|.  .|||
 Frog   281 KVLGVNFKSTMEEINRKYRELVKIWHPDHNRHRLEEAQEHFLEIQAAYETLMRLRKSK 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 23/59 (39%)
DnaJ 4..65 CDD:278647 23/59 (39%)
DnaJ_C 174..338 CDD:199909
dnajc22NP_001107370.1 TM2 1..50 CDD:282945
DnaJ 281..331 CDD:99751 19/50 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.