DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and dnajb4

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001096404.1 Gene:dnajb4 XenbaseID:XB-GENE-1007708 Length:357 Species:Xenopus tropicalis

Alignment Length:336 Identity:175/337 (52%)
Similarity:225/337 (67%) Gaps:40/337 (12%)


  Fly     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYD 65
            ||||||.:||:.|.|::|:|||||||.||::||||||:|:||:||||:|||||||||..||||||
 Frog     1 MGKDYYSVLGIEKGASEDDIKKAYRKQALKWHPDKNKSAHAEEKFKEIAEAYEVLSDPKKREVYD 65

  Fly    66 KYGEDGLKSGGTRNGGPSSN--SFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNL---FDKKVF 125
            ::||:|||.|   :|.|..:  :|.|.|||||.||||.|||.:|||..||  |..:   .|.:..
 Frog    66 QFGEEGLKGG---SGAPDGHGGNFHYTFHGDPHATFAAFFGGANPFEIFF--GRRMPGGRDDEDM 125

  Fly   126 DLDTEPDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQ-------KQDPPVEHDLYVT 183
            :||.:|  |||               ..||..:.|    |.:|.|       |||||:.|||.|:
 Frog   126 ELDGDP--FSS---------------FTSFNMNGF----PREKNQVGNQFRRKQDPPIIHDLRVS 169

  Fly   184 LEEIYHGCVKKMKISRRIVQADGSS-RKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIV 247
            |||||.||.|:|:|||:.:..||.| |.|:|.|.|.||.|||.|||:||.:|||:||..||||||
 Frog   170 LEEIYTGCTKRMRISRKRLNPDGRSVRTEDKILTIEIKKGWKEGTKITFPREGDEAPMTIPADIV 234

  Fly   248 FIIRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGY 312
            |:::||||..|||:||::....|::|::||||....|||:.|..:.: |:.:||||...:||.||
 Frog   235 FVVKDKPHTHFKRDGSNIVCPVRVSLREALCGCSINVPTLDGRSIPM-TINDIIKPGMRRRIIGY 298

  Fly   313 GLPFPKDTTRK 323
            ||||||....|
 Frog   299 GLPFPKKPRTK 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 175/337 (52%)
DnaJ 4..65 CDD:278647 44/61 (72%)
DnaJ_C 174..338 CDD:199909 83/152 (55%)
dnajb4NP_001096404.1 DnaJ_bact 4..307 CDD:274090 171/330 (52%)
DnaJ 4..65 CDD:278647 44/61 (72%)
DnaJ_C 160..304 CDD:199909 81/145 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1393097at2759
OrthoFinder 1 1.000 FOG0000281
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.790

Return to query results.
Submit another query.