DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5001 and dnajb12b

Sequence 1:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001082977.1 Gene:dnajb12b ZFINID:ZDB-GENE-070410-128 Length:159 Species:Danio rerio

Alignment Length:50 Identity:28/50 (56%)
Similarity:39/50 (78%) Gaps:0/50 (0%)


  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAY 52
            |:||:|||:.|.|::|::|||||||||::|||||.|..|.:.||..|..:
Zfish   108 KNYYEILGVQKDASEDDLKKAYRKLALKFHPDKNHAPGATEAFKGTASHF 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 28/50 (56%)
DnaJ 4..65 CDD:278647 27/49 (55%)
DnaJ_C 174..338 CDD:199909
dnajb12bNP_001082977.1 DnaJ 109..>151 CDD:278647 25/42 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.