DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4887 and AT2G42330

DIOPT Version :10

Sequence 1:NP_608582.2 Gene:CG4887 / 33304 FlyBaseID:FBgn0031318 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_181762.1 Gene:AT2G42330 / 818834 AraportID:AT2G42330 Length:752 Species:Arabidopsis thaliana


Alignment Length:131 Identity:34/131 - (25%)
Similarity:54/131 - (41%) Gaps:44/131 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   864 KENL--AKLNQNTSSSIEEALAYR--DRAKERRLKYGESDPPPPNRSRERFEQEIKTLQSRQKQS 924
            |:|.  .|:::|..:.:..||..:  |:|..|.          .|..:|.||:            
plant    59 KQNRGNCKIDENDDTILPIALGKKIADKAHVRE----------KNNKKENFEK------------ 101

  Fly   925 TSATPAMPISSSNVGSRLLQKMGWSEGQGLGRKNQGRTQIIEADGRSNYVGLGNKSGQMIPGNDY 989
                     .|..:|.:||:|||: :|:|||:..||....||...|...:|:|.        ||:
plant   102 ---------FSGGIGMKLLEKMGY-KGRGLGKNQQGIVAPIEVQLRPKNMGMGY--------NDF 148

  Fly   990 K 990
            |
plant   149 K 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4887NP_608582.2 U2AF_lg 93..>193 CDD:273727
RRM_SF 255..335 CDD:473069
ZnF_RBZ 341..364 CDD:197784
RanBP2-type Zn finger 342..361 CDD:275377
RRM1_RRM2_RBM5_like 387..473 CDD:409752
OCRE_RBM5_like 623..678 CDD:293881
OCRE repeat 1 628..635 CDD:293881
OCRE repeat 2 636..643 CDD:293881
OCRE repeat 3 644..651 CDD:293881
OCRE repeat 4 652..659 CDD:293881
OCRE repeat 5 661..668 CDD:293881
G-patch 935..979 CDD:396249 18/43 (42%)
AT2G42330NP_181762.1 TIP_N <5..>52 CDD:463593
G-patch 103..146 CDD:396249 18/51 (35%)
GCFC 323..587 CDD:400273
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.