DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tfb4 and TFB4

Sequence 1:NP_608574.2 Gene:Tfb4 FlyBaseID:FBgn0031309 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_015381.1 Gene:TFB4 SGDID:S000006260 Length:338 Species:Saccharomyces cerevisiae

Alignment Length:336 Identity:98/337 (29%)
Similarity:147/337 (44%) Gaps:68/337 (20%)


  Fly    12 ESCIDLLVIVLDTNPSQHFVRQNPQN----LTQILEAVIAFGNAHLMQKAQNKLAVVSCSHHATN 72
            |....||.::::..|..........|    :.::|||:|.|.||||...:.||:||::.......
Yeast    20 EESPSLLTVIIEIAPKLWTTFDEEGNEKGSIIKVLEALIVFLNAHLAFNSANKVAVIAAYSQGIK 84

  Fly    73 FLYPLPR---------------------------RQVELRQVDGQYEAFNLVEKTVKQQLGSILM 110
            :|||...                           |.|:...|:..|:.|.|.:|.::|       
Yeast    85 YLYPESTSALKASESENKTRSDLKIINSDMYRRFRNVDETLVEEIYKLFELEKKQIEQ------- 142

  Fly   111 NAPRLSAPCESLLAGSMSMALCYISRLQRNLAPGVKMHSRILVVTGSNECAS--------QYMTF 167
            |:.|      |.|||:||..|.|::|:.:. :....:.||:||:|    |.|        ||:..
Yeast   143 NSQR------STLAGAMSAGLTYVNRISKE-SVTTSLKSRLLVLT----CGSGSSKDEIFQYIPI 196

  Fly   168 MNVFFTAQKLGITIDTCAL--DKTLSLLQQGCDITSGQFLKVTQLDGLLQYLLWVFLPAPQIRHK 230
            ||..|:|.|:...||...:  .|..:.|||..|.|:|.:|.|...:||:|||.......|.:|..
Yeast   197 MNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDATNGVYLHVESTEGLIQYLATAMFIDPSLRPI 261

  Fly   231 LVLPPPPKVDYRASCFCHRELIDIGYVCSVCLSVFCKYSP--ICTTC------HTIFK-NPGPLP 286
            :|.|....||:|.||:....::.:|::|||||.|.....|  .|..|      |.|.| ...|:.
Yeast   262 IVKPNHGSVDFRTSCYLTGRVVAVGFICSVCLCVLSIIPPGNKCPACDSQFDEHVIAKLKRKPVV 326

  Fly   287 IKGKKKKKTDK 297
            .:.|.|||..|
Yeast   327 PRLKAKKKVTK 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tfb4NP_608574.2 Tfb4 15..276 CDD:281798 88/310 (28%)
TFB4NP_015381.1 TFB4 1..331 CDD:227567 94/329 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C235547503
eggNOG 1 0.900 E1_COG5242
Hieranoid 1 1.000
Homologene 1 1.000 H1160
Inparanoid 1 1.050 118 1.000 Inparanoid score I1300
Isobase 1 0.950 0 Normalized mean entropy S1938
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004058
OrthoInspector 1 1.000 T1136584
orthoMCL 1 0.900 OOG5_129096
Panther 1 1.100 LDO PTHR12831
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1503
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.