DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tfb4 and AT1G18340

Sequence 1:NP_608574.2 Gene:Tfb4 FlyBaseID:FBgn0031309 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_564050.1 Gene:AT1G18340 AraportID:AT1G18340 Length:301 Species:Arabidopsis thaliana

Alignment Length:290 Identity:107/291 (37%)
Similarity:160/291 (55%) Gaps:31/291 (11%)


  Fly     7 ASKEAESCIDLLVIVLDTNPSQHFVRQNPQNLTQILEAVIAFGNAHLMQKAQNKLAVVSCSHHAT 71
            |||:....:.|||::|||||.  |........:|.|..|:||.||.|.....|::.|::..:.:.
plant     5 ASKQYSDDVSLLVLLLDTNPL--FWSTTSITFSQFLSHVLAFLNAVLGLNQLNQVVVIATGYSSC 67

  Fly    72 NFLYPLPRRQVELRQVDGQYEA---------FNLVEK-----TVKQQLGSILMNAPRLSAPCESL 122
            :::|     ...|....|.:|:         .:|::|     |..::|....::..|:.: |  |
plant    68 DYIY-----DSSLTSNHGNFESNGTGMPAIFGSLLKKLEEFVTKDEELSKEEVSEDRIPS-C--L 124

  Fly   123 LAGSMSMALCYISRLQR--NLAPGVKMHSRILVVTGSNECASQYMTFMNVFFTAQKLGITIDTCA 185
            |:||:|||||||.|:.|  :|.|    ..|||.:.||.:...||:..||..|:||:|.:.||:|.
plant   125 LSGSLSMALCYIQRVFRSGHLHP----QPRILCLQGSPDGPEQYVAVMNSIFSAQRLMVPIDSCY 185

  Fly   186 LD-KTLSLLQQGCDITSGQFLKVTQLDGLLQYLLWVFLPAPQIRHKLVLPPPPKVDYRASCFCHR 249
            :. :..:.|||...||.|......|||||.|||..:|......|..:.||.|..||:|||||||:
plant   186 IGVQNSAFLQQASYITGGVHHTPKQLDGLFQYLTTIFATDLHSRGFVQLPKPIGVDFRASCFCHK 250

  Fly   250 ELIDIGYVCSVCLSVFCKYSPICTTCHTIF 279
            :.||:||:||||||:||::...|:||.::|
plant   251 KTIDMGYICSVCLSIFCEHHKKCSTCGSVF 280

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tfb4NP_608574.2 Tfb4 15..276 CDD:281798 103/278 (37%)
AT1G18340NP_564050.1 Tfb4 22..277 CDD:281798 98/269 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H1160
Inparanoid 1 1.050 160 1.000 Inparanoid score I1595
OMA 1 1.010
OrthoDB 1 1.010 D1220881at2759
OrthoInspector 1 1.000 T193527
orthoMCL 1 0.900 OOG5_129096
Panther 1 1.100 LDO PTHR12831
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.