DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tfb4 and gtf2h3

Sequence 1:NP_608574.2 Gene:Tfb4 FlyBaseID:FBgn0031309 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001121894.1 Gene:gtf2h3 ZFINID:ZDB-GENE-040718-302 Length:296 Species:Danio rerio

Alignment Length:285 Identity:138/286 (48%)
Similarity:185/286 (65%) Gaps:6/286 (2%)


  Fly    15 IDLLVIVLDTNP---SQHFVRQNPQNLTQILEAVIAFGNAHLMQKAQNKLAVVSCSHHATNFLYP 76
            |::||||||.||   .|...|:....|:..|::::...||||:....|||||::..:|.::||||
Zfish     7 INILVIVLDVNPVWWGQQAQREPKFTLSACLDSLMVLANAHLVMSRTNKLAVITSLYHESHFLYP 71

  Fly    77 LP--RRQVEL-RQVDGQYEAFNLVEKTVKQQLGSILMNAPRLSAPCESLLAGSMSMALCYISRLQ 138
            ..  |...|: ...||:||..::......:::.:::..|....:..|:|||.|::.|||||:|:.
Zfish    72 SKQWRSGEEISANPDGKYELLSVTNDLFAEEIRNLMERAEVSGSQTETLLAVSLARALCYINRIS 136

  Fly   139 RNLAPGVKMHSRILVVTGSNECASQYMTFMNVFFTAQKLGITIDTCALDKTLSLLQQGCDITSGQ 203
            :::..|.::.|||||:..:.:..||||.||||.|.|||..|.||.|.||....||||.||||.|.
Zfish   137 KDVQAGQEVKSRILVIKAAEDSTSQYMNFMNVIFAAQKKNILIDACVLDSDSGLLQQACDITGGL 201

  Fly   204 FLKVTQLDGLLQYLLWVFLPAPQIRHKLVLPPPPKVDYRASCFCHRELIDIGYVCSVCLSVFCKY 268
            :|:|.|...|.|||||||||..:.|.:|:||||..|||||:|||||.||:||||||||||:||.:
Zfish   202 YLRVPQKVALTQYLLWVFLPDAEQRSQLLLPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNF 266

  Fly   269 SPICTTCHTIFKNPGPLPIKGKKKK 293
            |||||||.|.||.|.|...|.||||
Zfish   267 SPICTTCETAFKMPLPQMAKTKKKK 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tfb4NP_608574.2 Tfb4 15..276 CDD:281798 128/267 (48%)
gtf2h3NP_001121894.1 Tfb4 7..274 CDD:281798 128/267 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C235533362
eggNOG 1 0.900 E1_COG5242
Hieranoid 1 1.000
Homologene 1 1.000 H1160
Inparanoid 1 1.050 267 1.000 Inparanoid score I2960
OMA 1 1.010
OrthoDB 1 1.010 D1220881at2759
OrthoFinder 1 1.000 FOG0004058
OrthoInspector 1 1.000 T1053898
orthoMCL 1 0.900 OOG5_129096
Panther 1 1.100 LDO PTHR12831
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1503
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.