DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tfb4 and GTF2H3

Sequence 1:NP_608574.2 Gene:Tfb4 FlyBaseID:FBgn0031309 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001507.2 Gene:GTF2H3 HGNCID:4657 Length:308 Species:Homo sapiens

Alignment Length:299 Identity:137/300 (46%)
Similarity:182/300 (61%) Gaps:17/300 (6%)


  Fly    12 ESCIDLLVIVLDTNP---SQHFVRQNPQNLTQILEAVIAFGNAHLMQKAQNKLAVVSCSHHATNF 73
            |..::|||||:|.||   .:..::::...|::.::||:..||:||.....|||||::.....:.|
Human     5 EDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRF 69

  Fly    74 LYP-----------LPRRQVELR---QVDGQYEAFNLVEKTVKQQLGSILMNAPRLSAPCESLLA 124
            |||           .|....|..   ..||:||......:.:.:::..::..:.......|:|||
Human    70 LYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLA 134

  Fly   125 GSMSMALCYISRLQRNLAPGVKMHSRILVVTGSNECASQYMTFMNVFFTAQKLGITIDTCALDKT 189
            ||::.|||||.|:.:.:....:|.|||||:..:.:.|.|||.||||.|.|||..|.||.|.||..
Human   135 GSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSD 199

  Fly   190 LSLLQQGCDITSGQFLKVTQLDGLLQYLLWVFLPAPQIRHKLVLPPPPKVDYRASCFCHRELIDI 254
            ..||||.||||.|.:|||.|:..|||||||||||....|.:|:||||..|||||:|||||.||:|
Human   200 SGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEI 264

  Fly   255 GYVCSVCLSVFCKYSPICTTCHTIFKNPGPLPIKGKKKK 293
            |||||||||:||.:|||||||.|.||...|..:|.||||
Human   265 GYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKK 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tfb4NP_608574.2 Tfb4 15..276 CDD:281798 127/278 (46%)
GTF2H3NP_001507.2 tfb4 7..289 CDD:273181 128/282 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C235533453
eggNOG 1 0.900 E1_COG5242
Hieranoid 1 1.000
Homologene 1 1.000 H1160
Inparanoid 1 1.050 263 1.000 Inparanoid score I3045
Isobase 1 0.950 0 Normalized mean entropy S1938
OMA 1 1.010
OrthoDB 1 1.010 D1220881at2759
OrthoFinder 1 1.000 FOG0004058
OrthoInspector 1 1.000 T1074626
orthoMCL 1 0.900 OOG5_129096
Panther 1 1.100 LDO PTHR12831
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1503
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.