DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tfb4 and Gtf2h3

Sequence 1:NP_608574.2 Gene:Tfb4 FlyBaseID:FBgn0031309 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001019407.1 Gene:Gtf2h3 RGDID:1305494 Length:309 Species:Rattus norvegicus

Alignment Length:313 Identity:139/314 (44%)
Similarity:185/314 (59%) Gaps:27/314 (9%)


  Fly     1 MEADQAASKEAESCIDLLVIVLDTNP---SQHFVRQNPQNLTQILEAVIAFGNAHLMQKAQNKLA 62
            |.||       |..::||||::||||   .:..::::...|::.::||:...||||.....|:||
  Rat     1 MAAD-------EDELNLLVIIVDTNPIWWGKQALKESQFTLSKCMDAVMVLANAHLFMNRSNQLA 58

  Fly    63 VVSCSHHATNFLYP----------------LPRRQVELRQVDGQYEAFNLVEKTVKQQLGSILMN 111
            |::.....:.||||                ||..... ...||:||......:.:.:::..::..
  Rat    59 VIASHIQESRFLYPGKNGRLGDFFGDPGNALPDCNPS-GSKDGKYELLTAANEVIAEEIKDLMTK 122

  Fly   112 APRLSAPCESLLAGSMSMALCYISRLQRNLAPGVKMHSRILVVTGSNECASQYMTFMNVFFTAQK 176
            :.......|:|||||::.|||||.|..:.:....:|.|||||:..:.:.|.|||.||||.|.|||
  Rat   123 SDIKGQHTETLLAGSLAKALCYIHRASKAVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQK 187

  Fly   177 LGITIDTCALDKTLSLLQQGCDITSGQFLKVTQLDGLLQYLLWVFLPAPQIRHKLVLPPPPKVDY 241
            ..|.||.|.||....||||.||||.|.:|||.|:..|||||||||||....|.:|:||||..|||
  Rat   188 QNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPIHVDY 252

  Fly   242 RASCFCHRELIDIGYVCSVCLSVFCKYSPICTTCHTIFKNPGPLPIKGKKKKK 294
            ||:|||||.||:||||||||||:||.:|||||||.|.||...|..:|.||||:
  Rat   253 RAACFCHRSLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKQ 305

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tfb4NP_608574.2 Tfb4 15..276 CDD:281798 126/280 (45%)
Gtf2h3NP_001019407.1 tfb4 7..290 CDD:273181 127/284 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C235531652
eggNOG 1 0.900 E1_COG5242
Hieranoid 1 1.000
Homologene 1 1.000 H1160
Inparanoid 1 1.050 258 1.000 Inparanoid score I3005
OMA 1 1.010
OrthoDB 1 1.010 D1220881at2759
OrthoFinder 1 1.000 FOG0004058
OrthoInspector 1 1.000 T1088269
orthoMCL 1 0.900 OOG5_129096
Panther 1 1.100 LDO PTHR12831
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.