DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tfb4 and tfb4

Sequence 1:NP_608574.2 Gene:Tfb4 FlyBaseID:FBgn0031309 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_595532.1 Gene:tfb4 PomBaseID:SPBC30B4.07c Length:297 Species:Schizosaccharomyces pombe

Alignment Length:277 Identity:95/278 (34%)
Similarity:155/278 (56%) Gaps:11/278 (4%)


  Fly     8 SKEAESCIDLLVIVLDTNPSQHFVRQNPQNLTQILEAVIAFGNAHLMQKAQNKLAVVSCSHHATN 72
            |::|.....|||::||.||:..:.......::::|..:..|.||||.....|::||::.......
pombe    16 SEDANDTPSLLVVILDANPASWYSLSKKVPVSKVLADITVFLNAHLAFHHDNRVAVLASHSDKVE 80

  Fly    73 FLYPLPRRQVELRQVD-----GQYEAFNLVEKTVKQQLGSILMNAPRLSAPCESLLAGSMSMALC 132
            :|||....:.::.:||     ..|..|..|:..|...:..::.:..::|.  :::::|::|.||.
pombe    81 YLYPSIAPEQKVAEVDPTKEANTYRKFREVDDLVLSGMKRLMSSTDKVSR--KTMISGALSRALA 143

  Fly   133 YISRLQRNLAPGVKMHSRILVVTGSNECASQYMTFMNVFFTAQKLGITIDTCALDKTLSLLQQGC 197
            ||:::|....    :.||||:.:.:.:.|.||:..||..|.|||..|.|:.|.::.....|:|..
pombe   144 YINQVQNKNT----LRSRILIFSLTGDVALQYIPTMNCIFCAQKKNIPINVCNIEGGTLFLEQAA 204

  Fly   198 DITSGQFLKVTQLDGLLQYLLWVFLPAPQIRHKLVLPPPPKVDYRASCFCHRELIDIGYVCSVCL 262
            |.|.|.:|||....||||||:....|...:|..|..|....||:||:||||::::|||:||||||
pombe   205 DATGGIYLKVDNPKGLLQYLMMSLFPDQNLRKHLNTPNQANVDFRATCFCHKKVLDIGFVCSVCL 269

  Fly   263 SVFCKYSPICTTCHTIF 279
            |:||:....|:||||.|
pombe   270 SIFCEPRVHCSTCHTKF 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tfb4NP_608574.2 Tfb4 15..276 CDD:281798 90/266 (34%)
tfb4NP_595532.1 TFB4 1..297 CDD:227567 95/278 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H1160
Inparanoid 1 1.050 175 1.000 Inparanoid score I1145
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004058
OrthoInspector 1 1.000 T1125541
orthoMCL 1 0.900 OOG5_129096
Panther 1 1.100 LDO PTHR12831
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1503
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.