DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tfb4 and Gtf2h3

Sequence 1:NP_608574.2 Gene:Tfb4 FlyBaseID:FBgn0031309 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_852075.1 Gene:Gtf2h3 MGIID:1277143 Length:309 Species:Mus musculus

Alignment Length:313 Identity:137/314 (44%)
Similarity:186/314 (59%) Gaps:27/314 (9%)


  Fly     1 MEADQAASKEAESCIDLLVIVLDTNP---SQHFVRQNPQNLTQILEAVIAFGNAHLMQKAQNKLA 62
            |.||       |..::||||::||||   .:..::::...|::.::||:...|:||.....|:||
Mouse     1 MAAD-------EDELNLLVIIVDTNPIWWGKQALKESQFTLSKCMDAVMVLANSHLFMNRSNQLA 58

  Fly    63 VVSCSHHATNFLYP----------------LPRRQVELRQVDGQYEAFNLVEKTVKQQLGSILMN 111
            |::.....:..|||                ||..... ...||:||...:..:.:.:::..::..
Mouse    59 VIASHIQESRLLYPGKNGGLGDFFGDPGNALPDCNPS-GSKDGKYELLTVANEVIAEEIKDLMTK 122

  Fly   112 APRLSAPCESLLAGSMSMALCYISRLQRNLAPGVKMHSRILVVTGSNECASQYMTFMNVFFTAQK 176
            :.......|:|||||::.|||||.|:.:.:....:|.|||||:..:.:.|.|||.||||.|.|||
Mouse   123 SDIKGQHTETLLAGSLAKALCYIHRVNKAVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQK 187

  Fly   177 LGITIDTCALDKTLSLLQQGCDITSGQFLKVTQLDGLLQYLLWVFLPAPQIRHKLVLPPPPKVDY 241
            ..|.||.|.||....||||.||||.|.:|||.|:..|||||||||||....|.:|:||||..|||
Mouse   188 QNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPIHVDY 252

  Fly   242 RASCFCHRELIDIGYVCSVCLSVFCKYSPICTTCHTIFKNPGPLPIKGKKKKK 294
            ||:|||||.||:||||||||||:||.:|||||||.|.||...|..:|.||||:
Mouse   253 RAACFCHRSLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKQ 305

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tfb4NP_608574.2 Tfb4 15..276 CDD:281798 124/280 (44%)
Gtf2h3NP_852075.1 tfb4 7..290 CDD:273181 125/284 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C235534439
eggNOG 1 0.900 E1_COG5242
Hieranoid 1 1.000
Homologene 1 1.000 H1160
Inparanoid 1 1.050 257 1.000 Inparanoid score I3128
Isobase 1 0.950 0 Normalized mean entropy S1938
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004058
OrthoInspector 1 1.000 T1084725
orthoMCL 1 0.900 OOG5_129096
Panther 1 1.100 LDO PTHR12831
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1503
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.