DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tfb4 and gtf-2H3

Sequence 1:NP_608574.2 Gene:Tfb4 FlyBaseID:FBgn0031309 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_499249.2 Gene:gtf-2H3 WormBaseID:WBGene00014230 Length:296 Species:Caenorhabditis elegans

Alignment Length:276 Identity:91/277 (33%)
Similarity:135/277 (49%) Gaps:36/277 (13%)


  Fly    41 ILEAVIAFGNAHLMQKAQNKLAVVSCSHHATN-FLYPLPRRQVELRQVDGQYEAFNLVEKTVKQQ 104
            ||.|:::|.||||.|.|.|:|.|.:...:..| .:|...|.:        ...|..||.|.:::.
 Worm    30 ILRAIVSFCNAHLGQSANNQLLVFAYGRNVDNKMIYSSTRCE--------DRNASFLVVKRLREL 86

  Fly   105 LGS-ILMNAPRLSAPCESLLAGSMSMALCYISRLQR---------NLAP----------GVKMHS 149
            |.| .|.|...:.||    |..:::.|.|::.:..|         :|.|          ..|..:
 Worm    87 LSSDALTNDATIGAP----LGPALAHAFCHMKKDSRVVTADPCDDSLGPQTTSEQSETASEKATN 147

  Fly   150 RILVVTGSNECASQYMTFMNVFFTAQKLGITIDTCAL--DKTLSLLQQGCDITSGQFLKVTQLDG 212
            |.:|::.:....|::.:.||:||:|.|..|.:|..::  |.|..:|||..|||.|.||...:...
 Worm   148 RAVVISITPIMGSEHGSLMNLFFSAAKQSICVDVVSMGDDFTGGILQQAADITGGSFLHAKKPQT 212

  Fly   213 LLQYLLWVFLPAPQIRHKLVLPPPPKVDYRASCFCHRELIDIGYVCSVCLSVFCKYSPICTTCHT 277
            ||:.|:...|..|..|..........|||||||.||.:|:..|:|||:||||.|:|:|||..|..
 Worm   213 LLKILMTNMLTDPTHRAVFSKLSHNSVDYRASCACHHQLVSSGWVCSICLSVLCQYTPICKVCKA 277

  Fly   278 IFKNPGPLPIKGKKKK 293
            .| ....||||..:|:
 Worm   278 AF-TIANLPIKPNRKR 292

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tfb4NP_608574.2 Tfb4 15..276 CDD:281798 85/258 (33%)
gtf-2H3NP_499249.2 tfb4 1..279 CDD:273181 85/261 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C235541575
eggNOG 1 0.900 E1_COG5242
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I3268
Isobase 1 0.950 0 Normalized mean entropy S1938
OMA 1 1.010
OrthoDB 1 1.010 D1220881at2759
OrthoFinder 1 1.000 FOG0004058
OrthoInspector 1 1.000 T476455
orthoMCL 1 0.900 OOG5_129096
Panther 1 1.100 LDO PTHR12831
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1503
TreeFam 1 0.960
1413.750

Return to query results.
Submit another query.