DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pkg21D and AT2G20050

Sequence 1:NP_477213.1 Gene:Pkg21D FlyBaseID:FBgn0000442 Length:768 Species:Drosophila melanogaster
Sequence 2:NP_179595.5 Gene:AT2G20050 AraportID:AT2G20050 Length:1094 Species:Arabidopsis thaliana

Alignment Length:692 Identity:200/693 (29%)
Similarity:336/693 (48%) Gaps:88/693 (13%)


  Fly    82 RNQNPHLCSSCGMVL-PTSPEFALEALSLGPLSPLASTSSASPS--GRTSADE-VRPKAMPAAIK 142
            ::..|...||.|..| |..|:.            :..|.|.|||  |..|.:: ||.....|.|:
plant   401 KDDAPRQLSSTGTQLQPPIPQV------------VELTGSESPSTFGWNSKNQRVRHDLSRARIR 453

  Fly   143 KQGVSAESCVQSMQQSYSIPIPKYEKDFSDKQQIKDAIMDNDFLKNIDASQVRELVDSMYSKSIA 207
            ....|.|:     ..::..|.|.:.|.:.::..|:..:.|:...:.:..||.:.|:|.|......
plant   454 AIENSLEN-----GHAWVPPSPAHRKTWEEEAHIERVLRDHFLFRKLTDSQCQVLLDCMQRLEAN 513

  Fly   208 AGEFVIREGEVGAHLYVSAAGEFAVM--QQGK------VLDKMGAGK--AFGELAILYNCTRTAS 262
            .|:.|:::|..|...||..:|||.|:  |.||      :|.:..|.|  :|||||:::|....||
plant   514 PGDIVVKQGGEGDCFYVVGSGEFEVLATQDGKNGEVPRILQRYTAEKQSSFGELALMHNKPLQAS 578

  Fly   263 IRVLSEAARVWVLDRRVFQQIMMCTGLQRIEN--SVNFLRSVPLLMNLSEELLAKIADVLELEFY 325
            :|.:.... :|.|.|..|:.|:|    ....|  |:..||||.||..|:...|:.:|:.|....:
plant   579 VRAVDHGT-LWALKREDFRGILM----SEFSNLASLKLLRSVDLLSRLTILQLSHVAESLSEACF 638

  Fly   326 AAGTYIIRQGTAGDSFFLISQGNVRV---TQKL----------------------TPTSPEETEL 365
            :.|..|:.:.......::|.:|.|::   |:.|                      |..|.|:.| 
plant   639 SDGQTIVTKDQKLQGLYVIQKGRVKISFCTEVLESQNVSSLTTGITNEYDNLEIGTEVSIEKHE- 702

  Fly   366 RTLSRGDYFGEQALINEDKRTANIIALSPGVECLTLDRDSFKRLIGDLCELKEKDYGDESRKLAM 430
                 |.||||.||:.|.|.:.:::|:.. |.|:.|.:::|:..:|.|..:  .|.|.::|..:.
plant   703 -----GSYFGEWALLGELKDSLSVVAVGE-VVCVVLTKENFESAVGPLTNI--SDDGPKTRHSSF 759

  Fly   431 KQAQESCRDEPKEQLQQEFPDLKLTDLEVVSTLGIGGFGRVELVKAHHQDRVDIFALKCLKKRHI 495
            :.::||.:......|.:    ..|.|||..:.|.......:.||  |.:|:.::.:||...|:.:
plant   760 ELSKESAKVTDTTALAK----ATLADLEWTTCLSTTDCSEIGLV--HLKDKENLLSLKRFSKQKV 818

  Fly   496 VDTKQEEHIFSERHIMLSSRSP--FICRLYRTFRDEKYVYMLLEACMGGEIWTMLRDRGSFEDNA 558
            ....:|..:..||::|.:...|  .:..:..|..|:.:..:||...:...|.::|  ....::::
plant   819 KKLGKEAQVLKERNLMKNVIKPSAIVPEILCTCVDQTFAAILLNTTLACPISSLL--HSPLDESS 881

  Fly   559 AQFIIGCVLQAFEYLHARGIIYRDLKPENLMLDERGYVKIVDFGFAKQIGTSSKTWTFCGTPEYV 623
            .:||.|.::.|.|.:|...|::|...||.||||:.||::||||.|||:: :..:|:|.||..:|:
plant   882 VRFITGSLVSAIEDIHKNEILFRGSSPELLMLDQSGYLQIVDFRFAKKL-SGERTFTICGNADYL 945

  Fly   624 APEIILNKGHDRAVDYWALGILIHELLNGTPPFSA--PDPMQTYNLILKGIDMIAFPKHISRWAV 686
            ||||:..|||..|.|:||||:||:.:|.|..||.:  ...:.|:..|.||  .:.||:.:|..|.
plant   946 APEIVQGKGHGYAADWWALGVLIYYMLEGEMPFGSWRESELDTFQKIAKG--QLTFPRVLSSEAE 1008

  Fly   687 QLIKRLCRDVPSERLGYQTGGIQDIKKHKWFLGFDWDGLASQ 728
            .||.:|.....:.|.|.| ||.:.||||.||.|..|:.::::
plant  1009 DLITKLLEVDENLRFGSQ-GGPESIKKHPWFNGLKWEAISNR 1049

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pkg21DNP_477213.1 Crp 183..386 CDD:223736 68/240 (28%)
CAP_ED 185..285 CDD:237999 35/110 (32%)
CAP_ED 304..419 CDD:237999 33/140 (24%)
Pkinase 457..717 CDD:278497 89/264 (34%)
STKc_cGK 463..724 CDD:270724 90/265 (34%)
S_TK_X 719..>760 CDD:214529 2/11 (18%)
AT2G20050NP_179595.5 PP2Cc 123..397 CDD:238083
Crp 485..>625 CDD:223736 46/145 (32%)
CAP_ED 491..600 CDD:237999 35/110 (32%)
CAP_ED 617..>714 CDD:237999 24/103 (23%)
PKc_like 797..1054 CDD:304357 89/262 (34%)
Pkinase 798..1038 CDD:278497 86/248 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 247 1.000 Inparanoid score I1013
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32281
orthoMCL 1 0.900 OOG5_127599
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
43.860

Return to query results.
Submit another query.