DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pkg21D and egl-4

Sequence 1:NP_477213.1 Gene:Pkg21D FlyBaseID:FBgn0000442 Length:768 Species:Drosophila melanogaster
Sequence 2:NP_001294450.1 Gene:egl-4 WormBaseID:WBGene00001173 Length:783 Species:Caenorhabditis elegans

Alignment Length:776 Identity:367/777 (47%)
Similarity:495/777 (64%) Gaps:92/777 (12%)


  Fly     9 REREAIVSNLTKDVQALREMVRSRESELVKLHREIHKLKSVLQQTTNNLNVTRNEKAKKKLYSLP 73
            |:::.||....|.:..|       |.|:..|.||..||:|||:|.                    
 Worm    84 RQQQTIVEGHIKRISEL-------EGEVTTLQRECDKLRSVLEQK-------------------- 121

  Fly    74 EQCGEQESRNQNPHLCSSCGMVLPTSPEFALEALSLGPLSPLASTSSASPSGRTS--ADEVRPKA 136
                                         |..|.|.|...|       |||.||.  .::::.||
 Worm   122 -----------------------------AQSAASPGGQPP-------SPSPRTDQLGNDLQQKA 150

  Fly   137 -MPA----AIKKQGVSAESCVQSMQQSYSIPIPKYEKDFSDKQQIKDAIMDNDFLKNIDASQVRE 196
             :||    ..||..||||   .:..::....:..|.|....||.|:||:..|||||.:...|:.|
 Worm   151 VLPADGVQRAKKIAVSAE---PTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIE 212

  Fly   197 LVDSMYSKSIAAGEFVIREGEVGAHLYVSAAGEFAVMQQGKVLDKMGAGKAFGELAILYNCTRTA 261
            ||:.||.....||::||:|||.|..|:|.|.||..|.::|.:|.||.||...|||||||||||||
 Worm   213 LVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTA 277

  Fly   262 SIRVLSEAARVWVLDRRVFQQIMMCTGLQRIENSVNFLRSVPLLMNLSEELLAKIADVLELEFYA 326
            |::.|:: .::|||||.|||.|....|::|....:|||..|.:..||||:.::|:|||::.::|.
 Worm   278 SVQALTD-VQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYD 341

  Fly   327 AGTYIIRQG---TAGDSFFLISQGNVRVTQKLTPTSPEETELRTLSRGDYFGEQALINEDKRTAN 388
            .|.||||||   ..||:||:|:.|.|:|||::...: |..|:|.|::||:|||:||:.|:.||||
 Worm   342 GGHYIIRQGEKCLQGDAFFVINSGQVKVTQQIEGET-EPREIRVLNQGDFFGERALLGEEVRTAN 405

  Fly   389 IIALSPGVECLTLDRDSFKRLIGDLCELKEKDYGDESRKLAMKQAQESCRDEPK-----EQLQQE 448
            |||.:||||.|||||:||.:|||||..|| |||||:.| ||     :..|:.|.     :..::|
 Worm   406 IIAQAPGVEVLTLDRESFGKLIGDLESLK-KDYGDKER-LA-----QVVREPPSPVKIVDDFREE 463

  Fly   449 FPDLKLTDLEVVSTLGIGGFGRVELVKAHHQDRVDIFALKCLKKRHIVDTKQEEHIFSERHIMLS 513
            |..:.|.:::.::|||:||||||||| ..:.|:...||||.|||:|||||:|:||||:||:||:.
 Worm   464 FAQVTLKNVKRLATLGVGGFGRVELV-CVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMME 527

  Fly   514 SRSPFICRLYRTFRDEKYVYMLLEACMGGEIWTMLRDRGSFEDNAAQFIIGCVLQAFEYLHARGI 578
            :.:.:|.:||:||||:|:||||||.|:|||:||.|||||.|:|..|:|.:.|||:..||||.:.|
 Worm   528 TSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNI 592

  Fly   579 IYRDLKPENLMLDERGYVKIVDFGFAKQIGTSSKTWTFCGTPEYVAPEIILNKGHDRAVDYWALG 643
            :||||||||.:|...||:|:|||||||::.:..||||||||||||:||||||||||:|.||||||
 Worm   593 VYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALG 657

  Fly   644 ILIHELLNGTPPFSAPDPMQTYNLILKGIDMIAFP-KHISRWAVQLIKRLCRDVPSERLGYQTGG 707
            |.|.||:.|.|||.|.|||:||.|||||:|.:..| :.|.:.|..|:|:||||.|.||||..:||
 Worm   658 IYICELMLGRPPFQASDPMKTYTLILKGVDALEIPNRRIGKTATALVKKLCRDNPGERLGSGSGG 722

  Fly   708 IQDIKKHKWFLGFDWDGLASQLLIPPFVRPIAHPTDVRYFDRFPCDLNEPPDELSGWDADF 768
            :.||:||:||:||||:||.|:.|.||.:..:::|.||..||.:|.|.:.||||.||||..|
 Worm   723 VNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 783

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pkg21DNP_477213.1 Crp 183..386 CDD:223736 100/206 (49%)
CAP_ED 185..285 CDD:237999 53/100 (53%)
CAP_ED 304..419 CDD:237999 63/118 (53%)
Pkinase 457..717 CDD:278497 160/261 (61%)
STKc_cGK 463..724 CDD:270724 164/262 (63%)
S_TK_X 719..>760 CDD:214529 20/41 (49%)
egl-4NP_001294450.1 Crp 195..>316 CDD:223736 61/122 (50%)
CAP_ED 201..314 CDD:237999 57/114 (50%)
Crp 313..>427 CDD:223736 60/115 (52%)
CAP_ED 319..437 CDD:237999 65/120 (54%)
PTZ00263 461..779 CDD:140289 187/319 (59%)
STKc_cGK 478..739 CDD:270724 164/262 (63%)
S_TK_X 734..783 CDD:214529 25/49 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4873221
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H4556
Inparanoid 1 1.050 677 1.000 Inparanoid score I367
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D123183at33208
OrthoFinder 1 1.000 FOG0001078
OrthoInspector 1 1.000 T475860
orthoMCL 1 0.900 OOG5_127599
Panther 1 1.100 O PTHR24353
Phylome 1 0.910 0.783 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2508
TreeFam 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.