DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and GABBR2

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:NP_005449.5 Gene:GABBR2 HGNCID:4507 Length:941 Species:Homo sapiens

Alignment Length:953 Identity:283/954 (30%)
Similarity:447/954 (47%) Gaps:160/954 (17%)


  Fly   155 LLGLFELSTSRGPRPDGLSELGAATMAVEHINRKRLLPGYTLELVTNDTQCDPGVGVDRFFHAIY 219
            ::||..|:........|...|.|..:|:|.|..:.||..|.|:|...||:||...|:..|:.||.
Human    58 IMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIK 122

  Fly   220 TQPSTRMVMLLGSACSEVTESLAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSSHNPA 284
            ..|:  .:|:.|..|..||..:|:.:..||:||:||.:|:|.|:|::::|||:|||..|::.|||
Human   123 YGPN--HLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPA 185

  Fly   285 RIAFIRKFGWGTVTTFSQNEEVHSLAVNNLVTELEAANISCAATITFA---ATDFKEQLLLLRET 346
            .:..::.:.|..|.|.:|:.:..|...|:|...|...:|..:.|.:|:   .|..|:    |:..
Human   186 ILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKK----LKGN 246

  Fly   347 DTRIIIGSFSQELAPQILCEAYRLRMFGADYAWILHESMGAPWWPDQRT-----ACSNHELQLAV 406
            |.|||:|.|.|.:|.::.|.||...|:|:.|.||:.......||....|     .|....|..|:
Human   247 DVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSSRCLRKNLLAAM 311

  Fly   407 ENLIVVSTHNSIVGNNVSYSGLNNHMFNSQLRKQSAQFHGQDGFGSGYGSRISIAATQSDSRRRR 471
            |..|           .|.:..|::....:...|...|:..:      |.:              :
Human   312 EGYI-----------GVDFEPLSSKQIKTISGKTPQQYERE------YNN--------------K 345

  Fly   472 RRGVGGTSGGHLFPEAISQYAPQTYDAVWAIALALRAAEEHWRRNEEQSKLDGFDYTRSDMAWEF 536
            |.|||        |.....||   ||.:|.||..|:.|.|....:....::..|:||...:....
Human   346 RSGVG--------PSKFHGYA---YDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRII 399

  Fly   537 LQQMGKLHFLGVSGPVSFSGPDRVGTTAFYQIQRGLLEPVALYYPATDALDFRCPRCRPVKWHSG 601
            |..|.:.:|.||:|.|.|...:|:||..|.|.|......|..|....|.|:....   .:::...
Human   400 LNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIIND---TIRFQGS 461

  Fly   602 QVPIAKRVFKLRVATIAPLAFYTIATLSSVGIALAIAFLAFNLHFRKLKAIKLSSPKLSNITAVG 666
            :.|..|.:...::..|:...:..::.|:.:|:.:|.|||.||:..|..|.||:|||.::|:..:|
Human   462 EPPKDKTIILEQLRKISLPLYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILG 526

  Fly   667 CIFVYATVILLGLDHSTLPSAEDSFATVCTARVYLLSAGFSLAFGSMFAKTYRVHRIFTRTGSVF 731
            .:..||::.|.|||.|.:  :|.:|.|:||.|.::|:.|::.|||:|||||:|||.||...  ..
Human   527 GMLSYASIFLFGLDGSFV--SEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNV--KM 587

  Fly   732 KDKMLQDIQLILLVGGLLLVDALLVTLWVVTDPMERHLHNLTLEISATDRSVVYQPQVEVCRSQH 796
            |.|:::|.:|:::|||:||:|..::..|...||:.|.:...::|.....|.:..:|.:|.|.:.|
Human   588 KKKIIKDQKLLVIVGGMLLIDLCILICWQAVDPLRRTVEKYSMEPDPAGRDISIRPLLEHCENTH 652

  Fly   797 TQTWLSVLYAYKGLLLVVGVYMAWETRHVKIPALNDSQYIGVSVYSVVITSAIVVVLANLISERV 861
            ...||.::|||||||::.|.::|||||:|.|||||||:|||:|||:|.|...|...::.|..::.
Human   653 MTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQP 717

  Fly   862 TLAFITITALILTSTTATLCLLFIPKLHDIWARNDIIDPVIHSMGLKMECNTRRFVVDDRRELQY 926
            .:.|..:..:|:..:|.||||:|:|||                    :...|........|..|:
Human   718 NVQFCIVALVIIFCSTITLCLVFVPKL--------------------ITLRTNPDAATQNRRFQF 762

  Fly   927 RVEVQNRVYKKEIQALDAEIRKLERLLESGLTTTSTTT--SSSTSLLTG----GGHLKPELT--- 982
               .||:  |||    |::            |:||.|:  .:|||.|.|    ...|:.::|   
Human   763 ---TQNQ--KKE----DSK------------TSTSVTSVNQASTSRLEGLQSENHRLRMKITELD 806

  Fly   983 -----VTSGISQTPAASK-----------------NRTPSISG---ILPNLLLSVLPPVIPRASW 1022
                 ||..:..||..:.                 |.|.|..|   ||.|.|     ...|:..|
Human   807 KDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNLGNFTESTDGGKAILKNHL-----DQNPQLQW 866

  Fly  1023 PSAEYMQ--------------IPMRRSVTFASQPQLEEACLPA 1051
            .:.|..:              |..|.|:..   |.|..|.||:
Human   867 NTTEPSRTCKDPIEDINSPEHIQRRLSLQL---PILHHAYLPS 906

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 128/441 (29%)
ANF_receptor 174..568 CDD:279440 119/402 (30%)
7tm_3 633..889 CDD:278433 107/256 (42%)
GABBR2NP_005449.5 PBP1_GABAb_receptor 58..443 CDD:107361 126/433 (29%)
7tmC_GABA-B-R2 480..749 CDD:320421 109/293 (37%)
TM helix 1 480..505 CDD:320421 8/25 (32%)
TM helix 2 517..538 CDD:320421 6/21 (29%)
TM helix 3 554..578 CDD:320421 13/24 (54%)
TM helix 4 597..617 CDD:320421 8/20 (40%)
TM helix 5 653..679 CDD:320421 14/26 (54%)
TM helix 6 688..711 CDD:320421 11/23 (48%)
TM helix 7 718..743 CDD:320421 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D267884at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10519
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.