DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and Gabbr2

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:NP_113990.1 Gene:Gabbr2 RGDID:619864 Length:940 Species:Rattus norvegicus

Alignment Length:953 Identity:285/954 (30%)
Similarity:447/954 (47%) Gaps:160/954 (17%)


  Fly   155 LLGLFELSTSRGPRPDGLSELGAATMAVEHINRKRLLPGYTLELVTNDTQCDPGVGVDRFFHAIY 219
            ::||..|:........|...|.|..:|:|.|..:.||..|.|:|...||:||...|:..|:.||.
  Rat    57 IMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIK 121

  Fly   220 TQPSTRMVMLLGSACSEVTESLAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSSHNPA 284
            ..|:  .:|:.|..|..||..:|:.:..||:||:||.:|:|.|:|::::|||:|||..|::.|||
  Rat   122 YGPN--HLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPA 184

  Fly   285 RIAFIRKFGWGTVTTFSQNEEVHSLAVNNLVTELEAANISCAATITFA---ATDFKEQLLLLRET 346
            .:..::.|.|..|.|.:|: :..|...|:|...|...:|..:.|.:|:   .|..|:    |:..
  Rat   185 ILKLLKHFRWRRVGTLTQDXQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKK----LKGN 245

  Fly   347 DTRIIIGSFSQELAPQILCEAYRLRMFGADYAWILHESMGAPWWPD-----QRTACSNHELQLAV 406
            |.|||:|.|.|.:|.::.|.|:...|||:.|.||:.......||..     ..:.|....|..|:
  Rat   246 DVRIILGQFDQNMAAKVFCCAFEESMFGSKYQWIIPGWYEPAWWEQVHVEANSSRCLRRSLLAAM 310

  Fly   407 ENLIVVSTHNSIVGNNVSYSGLNNHMFNSQLRKQSAQFHGQDGFGSGYGSRISIAATQSDSRRRR 471
            |..|           .|.:..|::....:...|...||..:      |.|              :
  Rat   311 EGYI-----------GVDFEPLSSKQIKTISGKTPQQFERE------YNS--------------K 344

  Fly   472 RRGVGGTSGGHLFPEAISQYAPQTYDAVWAIALALRAAEEHWRRNEEQSKLDGFDYTRSDMAWEF 536
            |.|||        |.....||   ||.:|.||..|:.|.|....:....::..|:||...:....
  Rat   345 RSGVG--------PSKFHGYA---YDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGKII 398

  Fly   537 LQQMGKLHFLGVSGPVSFSGPDRVGTTAFYQIQRGLLEPVALYYPATDALDFRCPRCRPVKWHSG 601
            |..|.:.:|.||:|.|.|...:|:||..|.|.|......|..|....|.|:....   .:::...
  Rat   399 LNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIIND---TIRFQGS 460

  Fly   602 QVPIAKRVFKLRVATIAPLAFYTIATLSSVGIALAIAFLAFNLHFRKLKAIKLSSPKLSNITAVG 666
            :.|..|.:...::..|:...:..::.|:.:|:.:|.|||.||:..|..|.||:|||.::|:..:|
  Rat   461 EPPKDKTIILEQLRKISLPLYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILG 525

  Fly   667 CIFVYATVILLGLDHSTLPSAEDSFATVCTARVYLLSAGFSLAFGSMFAKTYRVHRIFTRTGSVF 731
            .:..||::.|.|||.|.:  :|.:|.|:||.|.::|:.|::.|||:|||||:|||.||...  ..
  Rat   526 GMLSYASIFLFGLDGSFV--SEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNV--KM 586

  Fly   732 KDKMLQDIQLILLVGGLLLVDALLVTLWVVTDPMERHLHNLTLEISATDRSVVYQPQVEVCRSQH 796
            |.|:::|.:|:::|||:||:|..::..|...||:.|.:...::|.....|.:..:|.:|.|.:.|
  Rat   587 KKKIIKDQKLLVIVGGMLLIDLCILICWQAVDPLRRTVERYSMEPDPAGRDISIRPLLEHCENTH 651

  Fly   797 TQTWLSVLYAYKGLLLVVGVYMAWETRHVKIPALNDSQYIGVSVYSVVITSAIVVVLANLISERV 861
            ...||.::|||||||::.|.::|||||:|.|||||||:|||:|||:|.|...|...::.|..::.
  Rat   652 MTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQP 716

  Fly   862 TLAFITITALILTSTTATLCLLFIPKLHDIWARNDIIDPVIHSMGLKMECNTRRFVVDDRRELQY 926
            .:.|..:..:|:..:|.||||:|:|||                    :...|........|..|:
  Rat   717 NVQFCIVALVIIFCSTITLCLVFVPKL--------------------ITLRTNPDAATQNRRFQF 761

  Fly   927 RVEVQNRVYKKEIQALDAEIRKLERLLESGLTTTSTTT--SSSTSLLTG----GGHLKPELT--- 982
               .||:  |||    |::            |:||.|:  .:|||.|.|    ...|:.::|   
  Rat   762 ---TQNQ--KKE----DSK------------TSTSVTSVNQASTSRLEGLQSENHRLRMKITELD 805

  Fly   983 -----VTSGISQTPAASK-----------------NRTPSISG---ILPNLLLSVLPPVIPRASW 1022
                 ||..:..||..:.                 |.|.|..|   ||.|.|     ...|:..|
  Rat   806 KDLEEVTMQLQDTPEKTTYIKQNHYQELNDILSLGNFTESTDGGKAILKNHL-----DQNPQLQW 865

  Fly  1023 PSAEYMQ--------------IPMRRSVTFASQPQLEEACLPA 1051
            .:.|..:              |..|.|:..   |.|..|.||:
  Rat   866 NTTEPSRTCKDPIEDINSPEHIQRRLSLQL---PILHHAYLPS 905

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 130/441 (29%)
ANF_receptor 174..568 CDD:279440 121/402 (30%)
7tm_3 633..889 CDD:278433 107/256 (42%)
Gabbr2NP_113990.1 PBP1_GABAb_receptor 57..442 CDD:107361 128/433 (30%)
ANF_receptor 76..423 CDD:279440 117/395 (30%)
7tm_3 492..744 CDD:278433 107/276 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D267884at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10519
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.