DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and Gabbr1

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:XP_006255941.1 Gene:Gabbr1 RGDID:621537 Length:991 Species:Rattus norvegicus

Alignment Length:906 Identity:262/907 (29%)
Similarity:420/907 (46%) Gaps:128/907 (14%)


  Fly    96 RRQQRLNSHSNLPGSTNASHAHHLLNLPPRQRYLKVNQVFESERRMSPAEMQRNHGKIVLLG-LF 159
            |.:.|.:...:|.||:.:..:....:.|  :.:.:||:...||||            .|.:| ||
  Rat   125 RVEFRCDPDFHLVGSSRSVCSQGQWSTP--KPHCQVNRTPHSERR------------AVYIGALF 175

  Fly   160 ELSTSRGPRPDGLSELGAATMAVEHINRKR-LLPGYTLELVTNDTQCDPGVGVDRFFHAIYTQPS 223
            .:|   |..|.|.:...|..||:|.:|.:| :||.|.|:|:.:|::||||......:..:|..| 
  Rat   176 PMS---GGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDP- 236

  Fly   224 TRMVMLLGSACSEVTESLAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSSHNPARIAF 288
            .:::::.|  ||.|:..:|:....||::.:|:||:|||||:|:.||.|:||....:.|||.|:..
  Rat   237 IKIILMPG--CSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKL 299

  Fly   289 IRKFGWGTVTTFSQNEEVHSLAVNNLVTELEAANISCAATITFAATDFKEQLL---LLRETDTRI 350
            ..|:||..:.|..|..||.:..:::|...::.|.|.    |||..:.|.:..:   .|:..|.||
  Rat   300 FEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIE----ITFRQSFFSDPAVPVKNLKRQDARI 360

  Fly   351 IIGSFSQELAPQILCEAYRLRMFGADYAWILHESMGAPWWP--DQRTACSNHELQLAVENLIVVS 413
            |:|.|.:..|.::.||.|:.|:||..|.|.|.......|:.  |....|:..|:..|||..|...
  Rat   361 IVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKTYDPSINCTVEEMTEAVEGHITTE 425

  Fly   414 THNSIVGNNVSYSGLNNHMFNSQLRKQSAQFHGQDGFGSGYGSRISIAATQSDSRRRRRRGVGGT 478
            .......|..|.|.:.:..|..:|.|:                           .:|.....|| 
  Rat   426 IVMLNPANTRSISNMTSQEFVEKLTKR---------------------------LKRHPEETGG- 462

  Fly   479 SGGHLFPEAISQYAPQTYDAVWAIALALRAAEEHWRRNEEQSKLDGFDYTRSDMAWEFLQQMGKL 543
                      .|.||..|||:||:||||........|:  ..:|:.|:|....:..:..:.|...
  Rat   463 ----------FQEAPLAYDAIWALALALNKTSGGGGRS--GVRLEDFNYNNQTITDQIYRAMNSS 515

  Fly   544 HFLGVSGPVSF--SGPDRVGTTAFYQIQRGLLEPVALYYPATDALDFRCPRCRPVKWHSGQVPIA 606
            .|.||||.|.|  || .|:..|...|:|.|..:.:..|....|.|.:    .:..||..|..|..
  Rat   516 SFEGVSGHVVFDASG-SRMAWTLIEQLQGGSYKKIGYYDSTKDDLSW----SKTDKWIGGSPPAD 575

  Fly   607 KRVFKLRVATIAPLAFYTIATLSSVGIALAIAFLAFNLHFRKLKAIKLSSPKLSNITAVGCIFVY 671
            :.:.......::...|.:::.|||:||.||:..|:||::...::.|:.|.|.|:|:|||||....
  Rat   576 QTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLAL 640

  Fly   672 ATVILLGLDHSTLPSAEDSFATVCTARVYLLSAGFSLAFGSMFAKTYRVHRIFTRTGSVFKD--- 733
            |.|..||||...:  ....|..||.||::||..||||.:||||.|.:.||.:||:     |:   
  Rat   641 AAVFPLGLDGYHI--GRSQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTK-----KEEKK 698

  Fly   734 ---KMLQDIQLILLVGGLLLVDALLVTLWVVTDPMERHLHNLTLEISATDRSVVYQPQVEVCRSQ 795
               |.|:..:|...||.|:.:|.|.:.:|.:.||:.|.:.....|....|..|...||:|.|.|:
  Rat   699 EWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSK 763

  Fly   796 HTQTWL-------------------------------SVLYAYKGLLLVVGVYMAWETRHVKIPA 829
            ...|||                               |:.|.||||||::|:::|:||:.|....
  Rat   764 KMNTWLGELWSFAVSSDVQRRATVGGDSPICVWPAPESIFYGYKGLLLLLGIFLAYETKSVSTEK 828

  Fly   830 LNDSQYIGVSVYSVVITSAIVVVLANLISERVTLAFITITALILTSTTATLCLLFIPKLHDIWAR 894
            :||.:.:|:::|:|.:...|...:..::|.:...||...:..|:.|:..||.:||:||:..:..|
  Rat   829 INDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITR 893

  Fly   895 NDIIDPVIHSMGLKMECNTRRFVVDDRRELQYRVEVQNRVYKKEIQALDAEIRKLERLLES 955
            .:.......:|......|      ::..|....:|.:||..:|.|...:..:.:|...|:|
  Rat   894 GEWQSETQDTMKTGSSTN------NNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQS 948

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 132/442 (30%)
ANF_receptor 174..568 CDD:279440 120/402 (30%)
7tm_3 633..889 CDD:278433 96/293 (33%)
Gabbr1XP_006255941.1 Sushi 106..156 CDD:278512 6/33 (18%)
PBP1_GABAb_receptor 170..562 CDD:107361 132/447 (30%)
ANF_receptor 186..542 CDD:279440 120/404 (30%)
7tm_3 602..887 CDD:278433 96/292 (33%)
Ax_dynein_light <915..957 CDD:287215 9/35 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D267884at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.