DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and LOC560647

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:XP_021322611.1 Gene:LOC560647 ID: Length:903 Species:Danio rerio

Alignment Length:982 Identity:279/983 (28%)
Similarity:441/983 (45%) Gaps:162/983 (16%)


  Fly   152 KIVLLGLFELSTSRGPRPDGLSELGAATMAVEHINRKRL-LPGYTLELVTNDTQCDPGVGVDRFF 215
            |:.:|.:..||.:.|........|.|..:|::|::.:.. |..|.|:....|::||....:..||
Zfish    29 KLPVLWIMPLSGAPGKGNITAEVLPAVELALQHLSEQTSNLANYELQFHLTDSECDNSKALKAFF 93

  Fly   216 HAIYTQPSTRMVMLLGSACSEVTESLAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSS 280
            ..|::.|  :.:|:.|.|||.||..||:.:..||:||:||..|.|.|:|:|.||.|:|||..||:
Zfish    94 ETIFSGP--KPLMIFGGACSSVTSVLAQSLESWNLVQLSFAVTVPLLADKRRFPNFFRTVPSDSA 156

  Fly   281 HNPARIAFIRKFGWGTVTTFSQNEEVHSLAVNNLVTELEAANISCAATITF--AATDFKEQLLLL 343
            .|.|.:.|:|::||..|.|.:|.|:..:....:|...||.|||..|...:|  |..|..::   |
Zfish   157 VNVALVRFLRQYGWSRVGTLTQREQSFTEVQTDLNRHLEEANIQLAEAESFSEAPCDCVKK---L 218

  Fly   344 RETDTRIIIGSFSQELAPQILCEAYRLRMFGADYAWILHESMGAPWWPD-QRTACSNHELQLAVE 407
            ::.|.||:|..|.|.||.::.|..|.::|:|..|.|||.|.:.:..|.| ..|.|::..:..|:|
Zfish   219 KDNDVRIVIAHFDQSLAAKVFCCIYNVKMYGQKYQWILPEWVQSSRWTDIDSTNCTSENILTAIE 283

  Fly   408 NLIVVSTHNSIVGNNVSYSGLNNHMFNSQLRKQSAQFHGQDGFGSGYGSRISIAATQSDSRRRRR 472
            ..|.....:               :.:|.:|              |...|......:..:.||:.
Zfish   284 GSISADIES---------------LSSSHIR--------------GISGRTPQEYEKEYNERRQM 319

  Fly   473 RGVGGTSGGHLFPEAISQYAPQTYDAVWAIALALRAAEEHWRRNEEQSKLDGFDYTRSDMAWEFL 537
            :.:||           |::....||..|.||.||....|..:..|..|....|..|..::....|
Zfish   320 KQLGG-----------SKFHGFAYDGTWVIAKALTRVMETVKYRERYSVHRNFTLTDQEVGQMIL 373

  Fly   538 QQMGKLHFLGVSGPVSFSGPDRVGTTAFYQIQRGLLEPVALYYPATDALDFRCP----RCRPVKW 598
            :.|.|::|.||:|.|.|...:||....|.|.|.|....:..|...||.|:|..|    :.:|.|.
Zfish   374 EAMDKINFFGVTGHVMFQKGERVANVKFAQYQDGKAVDIEKYSAITDELEFISPIRFHKDKPTKD 438

  Fly   599 HSGQVPIAKRVFKLRVATIAPLAFYTIATLSSVGIALAIAFLAFNLHFRKLKAIKLSSPKLSNIT 663
            .:...|..||:..|..|.::.|.|        :||..|..||.|:|..|...||.:|.|.::::.
Zfish   439 RTHVYPHRKRISILLYAIVSFLTF--------LGIFTACIFLVFSLKHRSHWAISMSRPLMNSLI 495

  Fly   664 AVGCIFVYATVILLGLDHSTLPSAEDSFATVCTARVYLLSAGFSLAFGSMFAKTYRVHRIFTRTG 728
            .:|.:..|:::..:|||.|.:  ::..|...||.::..||.|.:.|||:||||.:::| :|.:..
Zfish   496 ILGAVLSYSSIFFMGLDGSYV--SDRVFEVSCTVQISCLSIGCTTAFGAMFAKIWQIH-LFFKNH 557

  Fly   729 SVFKDKMLQDIQLILLVGGLLLVD-ALLVTLWVVTDPMERHLHNLTLEISATDRSVVYQPQVEVC 792
            |:.| |..::....|||..|.|:| :||::|.|: ||..|.:....::.....:....||..|.|
Zfish   558 SIDK-KNTKNYGPNLLVILLFLIDLSLLISLQVL-DPFRRTVKEYRIQPHPHGQDFFIQPFSERC 620

  Fly   793 RSQHTQTWLSVLYAYKGLLLVVGVYMAWETRHVKIPALNDSQYIGVSVYSVVITSAIVVVLANLI 857
            .:.|...|::..|.|||.||:...::||.|||:.|||:|||:.|..||:    .|..|:::....
Zfish   621 ENTHGLFWMAAFYIYKGTLLLSTCFLAWSTRHMNIPAVNDSRSIRFSVF----VSVPVILIGTCA 681

  Fly   858 S----ERVTLAFITITALILTSTTATLCLLFIPKLHDIWARNDII-----DPVI----------H 903
            |    .|..:.|..:|.:|:|....|||::|:||:        ||     ||..          |
Zfish   682 SMFWQHRPNVQFCIVTLVIVTCCCCTLCMVFVPKI--------IIIRMGPDPAFLSRRFHLKQWH 738

  Fly   904 SMGLKMECNTRR-----------------FVVDDRRELQYRVEV---QNRVYKKEIQALDAEIRK 948
            |   ::|..|.:                 |::|....:...:.:   :|...::.|..||:|:..
Zfish   739 S---ELEKETEQNKDKRCMLEQRDPGLSVFMIDATLSISSSLTIHQSENLYLRRHINYLDSELED 800

  Fly   949 LERLLESGLTTTSTTTSSSTSLLTGGGHLKPELTVTSGISQTPAASKNRTPSISGILPNLLLSVL 1013
            |.|.|  .|..||             .|...::.||..:.:|........|..|....||...:.
Zfish   801 LTRQL--NLNETS-------------AHAMEKVIVTGFVHKTAKDKCLTLPESSRCDRNLHQDIN 850

  Fly  1014 PP--VIPRASWPSAEYMQIPMRRSVTFASQPQLEEACLPA-----QDLINLRLAHQQATEAKTGL 1071
            .|  |..|.|      :|:|:           |..|.||:     :|...|....|..|....||
Zfish   851 SPEHVRRRLS------LQLPI-----------LHHAYLPSVGGVMEDSSPLYSPLQTPTTGSYGL 898

  Fly  1072 INRLRGI 1078
            :  |.|:
Zfish   899 L--LTGL 903

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 131/437 (30%)
ANF_receptor 174..568 CDD:279440 121/398 (30%)
7tm_3 633..889 CDD:278433 88/261 (34%)
LOC560647XP_021322611.1 PBP1_GABAb_receptor 35..407 CDD:107361 125/417 (30%)
7tm_GPCRs 453..720 CDD:333717 94/292 (32%)
TM helix 1 453..477 CDD:320095 10/32 (31%)
TM helix 2 489..510 CDD:320095 3/21 (14%)
TM helix 3 526..548 CDD:320095 11/22 (50%)
TM helix 4 571..587 CDD:320095 8/16 (50%)
TM helix 5 625..648 CDD:320095 8/23 (35%)
TM helix 6 658..683 CDD:320095 9/29 (31%)
TM helix 7 690..715 CDD:320095 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D267884at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.