DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and gabbr2

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:NP_001137515.1 Gene:gabbr2 ZFINID:ZDB-GENE-060503-620 Length:935 Species:Danio rerio

Alignment Length:1027 Identity:307/1028 (30%)
Similarity:467/1028 (45%) Gaps:203/1028 (20%)


  Fly   162 STSRGPRPDGLSELGAATMAVEHINRKRLLPGYTLELVTN--DTQCDPGVGVDRFFHAIYTQPST 224
            |.|:|..|       |..:|::||...|   .|:..|:|.  ||:||...|:..||.||...|  
Zfish    70 SISQGIEP-------AVQLAIQHIRESR---QYSFSLITKIYDTECDNAKGLRAFFDAICYGP-- 122

  Fly   225 RMVMLLGSACSEVTESLAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSSHNPARIAFI 289
            :.:|:.|..|..||..:|:.:..||:||:||.:|:|.|:||:::|.|:|||..|::.|||.:.|:
Zfish   123 KHLMIFGGVCPSVTSIIAESLEGWNLVQLSFAATTPVLADRKKYPNFFRTVPSDNAVNPAVVKFL 187

  Fly   290 RKFGWGTVTTFSQNEEVHSLAVNNLVTELEAANISCAATITFAATDFKEQLLLLRETDTRIIIGS 354
            ..:.|..|.|.:|:.:..|...|:|..|||.|:|..|.|.:| :.|....:..|::.|.|||||.
Zfish   188 NFYNWSRVGTLTQDVQRFSEVRNDLTNELEKADIQIADTESF-SNDPCVNVKKLKDNDVRIIIGQ 251

  Fly   355 FSQELAPQILCEAYRLRMFGADYAWILHESMGAPWWPD-QRTACSNHELQLAVENLIVVSTHNSI 418
            |.:.||.::.|.||.|.|:|:.|.||:.......||.. ..|.|:..:|..|:|..|.|.     
Zfish   252 FDENLAAKVFCCAYNLNMYGSKYQWIIPGWYQGNWWEQANSTNCTTRKLLTAMEGYISVD----- 311

  Fly   419 VGNNVSYSGLNNHMFNSQLRKQSAQFHGQDGFGSGYGSRISIAATQSDSRRRRRRGVGGTSGGHL 483
                          |.....||.          .|...|......:..:|.|.::|| .||..|.
Zfish   312 --------------FEPLSAKQI----------KGISGRTPQEYEREYNRERDQKGV-ETSKFHG 351

  Fly   484 FPEAISQYAPQTYDAVWAIALALRAAEEHWRRNEEQSKLDGFDYTRSDMAWEFLQQMGKLHFLGV 548
            |          .||.:|.||..|....|..|..|.......|.....::....|..|.:.:|.||
Zfish   352 F----------AYDGIWVIAKTLTRVMELLRHKERHDMYHNFTVDDREVGKMVLDVMNETNFFGV 406

  Fly   549 SGPVSFSGPDRVGTTAFYQIQRGLLEPVALYYPATDALDFRCPRCRPVKWHSGQVPIAKRVF-KL 612
            :|.|.|...:|:||..|.|.|.|....|..|....|.||......|    ..|..|...|.| :|
Zfish   407 TGQVMFRNGERMGTIKFTQFQEGQEVKVGEYNAIADVLDLINNTIR----FQGVEPPKDRTFVRL 467

  Fly   613 RVATIAPLAFYTIATLSSVGIALAIAFLAFNLHFRKLKAIKLSSPKLSNITAVGCIFVYATVILL 677
            :...|....:..::|::.:|:.:..|||.||:..|..:.||:|||.::|:..:|.:..||::.|.
Zfish   468 QRRQINVPLYSILSTITILGMLMGGAFLFFNIKNRNHRLIKMSSPYMNNLIILGGMLSYASIFLF 532

  Fly   678 GLDHSTLPSAEDSFATVCTARVYLLSAGFSLAFGSMFAKTYRVHRIFTRTGSVFKDKMLQDIQLI 742
            |||.|.:...|  |.|:||.|.::|..|::.|||:|||||:|||.||...  ..|.|:::|.:|.
Zfish   533 GLDGSFVSDKE--FETLCTVRTWILIVGYTTAFGAMFAKTWRVHAIFKNV--KMKKKIIKDQKLF 593

  Fly   743 LLVGGLLLVDALLVTLWVVTDPMERHLHNLTLEISATDRSVVYQPQVEVCRSQHTQTWLSVLYAY 807
            ::|||:||:|..::..|.:.||::|.:...:||.....|.:..:|.:|.|.:.|...||.::|||
Zfish   594 IIVGGMLLIDLCILICWQIVDPLKRTVEEYSLEADPQGRDIAIRPFLEHCENTHMTIWLGIVYAY 658

  Fly   808 KGLLLVVGVYMAWETRHVKIPALNDSQYIGVSVYSVVITSAIVVVLANLISERVTLAFITITALI 872
            ||||::.|.::|||||:|.|||||||:|||:|||:|.|...|...::.|..::..:.|..:..:|
Zfish   659 KGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQFCIVALVI 723

  Fly   873 LTSTTATLCLLFIPKLHDIWARNDIIDPVIHSMGLKMECNTRRFVVDDRRELQYRVEVQNRVYKK 937
            :..:|.||||:|:||.                    :...|........|.|::   .||:  ||
Zfish   724 IFCSTITLCLVFVPKF--------------------VTMRTNPDAATQNRRLKF---TQNQ--KK 763

  Fly   938 EIQALDAEIRKLERLLESGLTTTSTTT--SSSTSLLTG----GGHLKPELT--------VTSGIS 988
            |    |::            |:||.|:  .::||.|.|    ...|:.::|        ||..:.
Zfish   764 E----DSK------------TSTSVTSVNQANTSRLDGLQSDNHRLRMKITELDKELEEVTMQLQ 812

  Fly   989 QTPAASKNRTPSISGIL---PNLLLSV------------LPPVI---PRASWPSAEYMQIPMRRS 1035
            .||    .:||.|....   .|.:||:            |...:   |:|.|.||:..:|     
Zfish   813 DTP----EKTPYIKQNHYQDANNILSIRNFTDGKDGEKSLKNHLEQKPQAQWGSADPSRI----- 868

  Fly  1036 VTFASQPQLEEACLPAQDLINLRLAHQQATEAKTGLINRLRGIFSRTTSSNKGSTASLADQKGLK 1100
                |:..||:...|  :.|..||:.|...                                 |.
Zfish   869 ----SRGPLEDINSP--EHIQRRLSLQLPI---------------------------------LH 894

  Fly  1101 AAFKSHMGLFTRLIPSSQTASCNAIYNNPNQDSIPSEASSHPNGNHLKPIHR 1152
            .|:...:|        ...|||::..::|         ||.|...|:.|.:|
Zfish   895 HAYLPSIG--------GVDASCSSPTSSP---------SSSPRHRHMPPSYR 929

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 136/431 (32%)
ANF_receptor 174..568 CDD:279440 125/397 (31%)
7tm_3 633..889 CDD:278433 105/256 (41%)
gabbr2NP_001137515.1 PBP1_GABAb_receptor 58..440 CDD:107361 133/423 (31%)
ANF_receptor 76..419 CDD:279440 122/396 (31%)
7tm_3 488..739 CDD:278433 105/255 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D267884at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10519
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.