DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and gabbr1b

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:XP_005170159.1 Gene:gabbr1b ZFINID:ZDB-GENE-060503-5 Length:994 Species:Danio rerio

Alignment Length:852 Identity:253/853 (30%)
Similarity:410/853 (48%) Gaps:108/853 (13%)


  Fly   152 KIVLLGLFELSTSRGPRPDGLSELGAATMAVEHINRKR-LLPGYTLELVTNDTQCDPGVGVDRFF 215
            |:.:..||.:|   |..|.|.:.|.||.||::.:|::. :||.|.|||:..|:.||||......:
Zfish   165 KLYIGALFPMS---GGWPGGQACLPAAQMALDLVNKRTDILPDYELELIHYDSMCDPGEATKLLY 226

  Fly   216 HAIYTQPSTRMVMLLGSACSEVTESLAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSS 280
            ..:||:| .::|::.|  ||.|:..:|:....||::.:|:||:|||||:|:.||.|:||....:.
Zfish   227 DLLYTEP-IKIVLMPG--CSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATL 288

  Fly   281 HNPARIAFIRKFGWGTVTTFSQNEEVHSLAVNNLVTELEAANISCAATITFAATDFKEQLLLLRE 345
            |||.|:...:|:.|..:.|..|..||.:..:::|...::.|.|..:...:| .||....:..|:.
Zfish   289 HNPTRVQLFQKWKWTKIATIQQTTEVFTSTLDDLEQRVKEAGIEISVRQSF-LTDPAVAVKNLKR 352

  Fly   346 TDTRIIIGSFSQELAPQILCEAYRLRMFGADYAWILHESMGAPWW--PDQRTACSNHELQLAVE- 407
            .|.|||:|.|.:..|.::.||.|:.:::|..|.|.|.......|:  .|....|:..::..||| 
Zfish   353 QDARIIVGLFYETEARKVFCEVYKEKLYGKKYVWFLIGWYADNWFKIKDPSINCTVEQMTEAVEG 417

  Fly   408 ---NLIVVSTHNSIVGNNVSYSGLNNHMFNSQLRKQSAQFHGQDGFGSGYGSRISIAATQSDSRR 469
               ..||:....::.|    .|.|.:..|.:||..:                             
Zfish   418 HVTTEIVMLNPETVRG----ASNLTSQEFLAQLMSK----------------------------- 449

  Fly   470 RRRRGVGGTSGGHLFPEAIS--QYAPQTYDAVWAIALALRAA----EEHWRRNEEQSKLDGFDYT 528
                 :||.:     ||...  |.||..||||||:||||...    :...||      |:.|:|.
Zfish   450 -----LGGKN-----PEETGGFQEAPLAYDAVWALALALNKTVGPLKAKGRR------LEDFNYN 498

  Fly   529 RSDMAWEFLQQMGKLHFLGVSGPVSFSGP-DRVGTTAFYQIQRGLLEPVALYYPATDALDFRCPR 592
            ..|:..|..:.:....|.||||.|.|... .|:..|...|:|.|..:.:. ||..|..       
Zfish   499 NKDITAEIYRALNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIG-YYDMTKG------- 555

  Fly   593 CRPVKWHS-----GQVPIAKR---VFKLRVATIAPLAFYTIATLSSVGIALAIAFLAFNLHFRKL 649
              .:.|:.     |..|.|.:   :.|.|.  ::...|.:::..:.:||.:.|..|.||::...:
Zfish   556 --NLSWYGNDRWIGSGPPADQTVVIQKFRY--LSQKLFVSVSVFAGLGILMGIVCLTFNIYNSNV 616

  Fly   650 KAIKLSSPKLSNITAVGCIFVYATVILLGLDHSTLPSAEDSFATVCTARVYLLSAGFSLAFGSMF 714
            :.|:.|.|.|:|:|||||:...|.|..||:|  .|......|..||..|::||..|||||:||||
Zfish   617 RYIQNSQPYLNNMTAVGCMMALAAVFPLGID--GLHVRNSQFPVVCQFRLWLLGLGFSLAYGSMF 679

  Fly   715 AKTYRVHRIFTRTGSVFKDKMLQDIQ---LILLVGGLLLVDALLVTLWVVTDPMERHLHNLTLEI 776
            .|.:.||.:||:.... |||..|.::   |...||.||::|.|.:.:|.:.||:...:...|.|.
Zfish   680 TKIWWVHTVFTKKDEK-KDKRKQHLEPWKLYATVGVLLVIDILSLMIWQIVDPLHITVEKFTKEA 743

  Fly   777 SATDRSVVYQPQVEVCRSQHTQTWLSVLYAYKGLLLVVGVYMAWETRHVKIPALNDSQYIGVSVY 841
            ...|...:.:|.::.|.|:...|||.|:|.||||||::|:::|:||:.|....:||.:.:|:::|
Zfish   744 PKGDVDELIEPLLQHCSSEKMNTWLGVVYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIY 808

  Fly   842 SVVITSAIVVVLANLISERVTLAFITITALILTSTTATLCLLFIPKLHDIWARNDIIDPVIHSMG 906
            :|.:...|...:..::|.:...:|...:..|:.|...||.:||:||:..:..|.:.......:|.
Zfish   809 NVSVLCMITAPVTMILSSKQDASFAFASLAIIFSVYITLVVLFVPKMRRLITRGEWQSDQQETMK 873

  Fly   907 LKMECNTRRFVVDDRRELQYRVEVQNRVYKKEIQALDAEIRKL------ERLLESGLTTTSTTTS 965
            .....|..    |:.:..|  :|.:|:..:|.||..:..:.:|      .:.|.|....||....
Zfish   874 TGSSTNNN----DEEKSRQ--LERENKELQKIIQEKEERVSELRNQLSERQALRSRKRPTSNQNH 932

  Fly   966 SSTSLLT 972
            ||.|:.|
Zfish   933 SSPSIPT 939

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 132/447 (30%)
ANF_receptor 174..568 CDD:279440 121/408 (30%)
7tm_3 633..889 CDD:278433 93/259 (36%)
gabbr1bXP_005170159.1 CCP 97..154 CDD:214478
PBP1_GABAb_receptor 167..560 CDD:107361 133/459 (29%)
ANF_receptor 183..540 CDD:279440 121/410 (30%)
7tm_3 600..855 CDD:278433 93/258 (36%)
DD_cGKI 895..>923 CDD:213458 6/28 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D267884at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.