DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and gabbr2

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:NP_001016007.2 Gene:gabbr2 XenbaseID:XB-GENE-5815161 Length:962 Species:Xenopus tropicalis

Alignment Length:981 Identity:292/982 (30%)
Similarity:460/982 (47%) Gaps:166/982 (17%)


  Fly    60 SSPSSSPPGESASTVTAGG----TPIPPRSDWKYKRTKVKRRQQRLNSHSNLPGSTNASHAHHLL 120
            :||.:.|..|:.....|||    |.:.|:.                              |..:.
 Frog    10 NSPCALPGAETPQAAGAGGAESATGVSPKP------------------------------AIQMP 44

  Fly   121 NLPPRQRYLKVNQ------VFESERRMSPAEMQRNHGKIVLLGLFELSTSRGPRPDGLSELGAAT 179
            .|||:...|.:..      |:.|  |.:..|...|...:.::||..|:.:......|...|.|..
 Frog    45 MLPPQCLLLVLGLGLGPGFVYGS--RGTTIEQPANGTSLSIMGLMPLNETVAKGNIGRGVLPAVQ 107

  Fly   180 MAVEHINRKRLLPGYTLELVTNDTQCDPGVGVDRFFHAIYTQPSTRMVMLLGSACSEVTESLAKV 244
            :|::.|....||..|.|:|...||.||...|:..|:.||...|:  .:|:.|..|..||..:|:.
 Frog   108 LAIDQIRNISLLHPYFLDLKLYDTACDNAQGLKAFYDAIKYGPN--HLMVFGGVCPSVTSIIAES 170

  Fly   245 VPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSSHNPARIAFIRKFGWGTVTTFSQNEEVHSL 309
            :..||:||:||.:|:|.|:|::::|||:|||..|::.|||.:.|::.|.|..|.|.:|:.:..|.
 Frog   171 LKGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAIVKFLKHFKWKRVGTLTQDIQRFSE 235

  Fly   310 AVNNLVTELEAANISCAATITFAATDFKEQLLLLRETDTRIIIGSFSQELAPQILCEAYRLRMFG 374
            ..|:|..|||.:.|..|.|.:| :.|....:..|:..|.|||||.|.:.:|.::.|.|:...|:|
 Frog   236 VRNDLTGELEDSAIQIADTESF-SNDPCSSVKKLKGNDVRIIIGQFDEHMAAKVFCCAFDEDMYG 299

  Fly   375 ADYAWILHESMGAPWWPDQRTA-CSNHELQLAVENLIVVSTHNSIVGNNVSYSGLNNHMFNSQLR 438
            :.|.||:.....|.||....|: ||...|..|:|..|.|...........:.||.....:..:..
 Frog   300 SKYQWIIPGWYQALWWQQANTSTCSTKNLLTAMEGYIGVDFEPLSTKQIKTISGRTPQQYEKEYN 364

  Fly   439 KQSA-----QFHGQDGFGSGYGSRISIAATQSDSRRRRRRGVGGTSGGHLFPEAISQYAPQTYDA 498
            ::.|     :|||                                            ||   ||.
 Frog   365 EKRAGVEPSKFHG--------------------------------------------YA---YDG 382

  Fly   499 VWAIALALRAAEEHWRRNEEQSKLDGFDYTRSDMAWEFLQQMGKLHFLGVSGPVSFSGPDRVGTT 563
            :|.||..|..|.|:...::::.::..|:||...:...||..|.:.:|.||:|.|.|...:|:||.
 Frog   383 IWVIAKTLHRALEYLYSSKQRQRIQDFNYTDHKLGKIFLDAMNETNFFGVTGQVVFRNGERMGTI 447

  Fly   564 AFYQIQRGLLEPVALYYPATDALDFRCPRCRPVKWHSGQVPIAKRVFKLRVATIAPLAFYTI-AT 627
            .|.|.|.|....|..|....|:|:......|    ..|..|...:.|.........|..|:| :|
 Frog   448 KFTQFQDGKEVKVGEYNAVADSLELINDTIR----FQGVEPPKDQTFIREERRQIYLPLYSILST 508

  Fly   628 LSSVGIALAIAFLAFNLHFRKLKAIKLSSPKLSNITAVGCIFVYATVILLGLDHSTLPSAEDSFA 692
            |:.:|:.:|..||.||:..|..|.||:|||.::|:..:|.:..||::.|.|||.|.:  :.::|.
 Frog   509 LTIIGMIMASTFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLDGSFV--SANTFE 571

  Fly   693 TVCTARVYLLSAGFSLAFGSMFAKTYRVHRIFTRTGSVFKDKMLQDIQLILLVGGLLLVDALLVT 757
            |:||.|.::|:.|::.|||:|||||:|||.||...  ..|.|:::|.:|:::|||:||:|..::.
 Frog   572 TLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNV--KMKKKIIKDQKLLVIVGGMLLIDLCILI 634

  Fly   758 LWVVTDPMERHLHNLTLEISATDRSVVYQPQVEVCRSQHTQTWLSVLYAYKGLLLVVGVYMAWET 822
            .|.:.||::|.:....||.....|.:..:|.:|.|.:.|...||.::|||||||::.|.::||||
 Frog   635 CWQIVDPLKRTVEEYNLEPDPAGRDIAIRPFLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWET 699

  Fly   823 RHVKIPALNDSQYIGVSVYSVVITSAIVVVLANLISERVTLAFITITALILTSTTATLCLLFIPK 887
            |:|.|||||||:|||:|||:|.|...|...::.|..::..:.|..:..:|:..:|.||||:|:||
 Frog   700 RNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQFCIVALVIIFCSTITLCLVFVPK 764

  Fly   888 LHDIWARNDIIDPVIHSMGLKMECNTRRFVVDDRRELQYRVEVQNRVYKKEIQALDAEIRKLERL 952
            |                    :...|........|..|:   ..|:  |||    |::       
 Frog   765 L--------------------ITLRTNPDAATQNRRFQF---THNQ--KKE----DSK------- 793

  Fly   953 LESGLTTTSTTT--SSSTSLLTG----GGHLKPELT--------VTSGISQTPAAS----KNRTP 999
                 |:||.|:  .:|||.|.|    ...|:.::|        ||..:..||..:    :|...
 Frog   794 -----TSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQ 853

  Fly  1000 SISGIL 1005
            .::.||
 Frog   854 DLNDIL 859

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 131/439 (30%)
ANF_receptor 174..568 CDD:279440 121/400 (30%)
7tm_3 633..889 CDD:278433 106/256 (41%)
gabbr2NP_001016007.2 PBP1_GABAb_receptor 85..464 CDD:107361 129/429 (30%)
ANF_receptor 102..445 CDD:279440 117/393 (30%)
7tm_3 514..766 CDD:278433 106/276 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D267884at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.