DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and Gabbr1

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:NP_062312.3 Gene:Gabbr1 MGIID:1860139 Length:960 Species:Mus musculus

Alignment Length:871 Identity:260/872 (30%)
Similarity:417/872 (48%) Gaps:97/872 (11%)


  Fly   100 RLNSHSNLPGSTNASHAHHLLNLPPRQRYLKVNQVFESERRMSPAEMQRNHGKIVLLG-LFELST 163
            |.:...:|.||:.:..:....:.|  :.:.:||:...||||            .|.:| ||.:| 
Mouse   129 RCDPDFHLVGSSRSICSQGQWSTP--KPHCQVNRTPHSERR------------AVYIGALFPMS- 178

  Fly   164 SRGPRPDGLSELGAATMAVEHINRKR-LLPGYTLELVTNDTQCDPGVGVDRFFHAIYTQPSTRMV 227
              |..|.|.:...|..||:|.:|.:| :||.|.|:|:.:|::||||......:..:|..| .:::
Mouse   179 --GGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDP-IKII 240

  Fly   228 MLLGSACSEVTESLAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSSHNPARIAFIRKF 292
            ::.|  ||.|:..:|:....||::.:|:||:|||||:|:.||.|:||....:.|||.|:....|:
Mouse   241 LMPG--CSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKW 303

  Fly   293 GWGTVTTFSQNEEVHSLAVNNLVTELEAANISCAATITFAATDFKEQLL---LLRETDTRIIIGS 354
            ||..:.|..|..||.:..:::|...::.|.|.    |||..:.|.:..:   .|:..|.|||:|.
Mouse   304 GWKKIATIQQTTEVFTSTLDDLEERVKEAGIE----ITFRQSFFSDPAVPVKNLKRQDARIIVGL 364

  Fly   355 FSQELAPQILCEAYRLRMFGADYAWILHESMGAPWWP--DQRTACSNHELQLAVENLIVVSTHNS 417
            |.:..|.::.||.|:.|:||..|.|.|.......|:.  |....|:..|:..|||..|.......
Mouse   365 FYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKTYDPSINCTVEEMTEAVEGHITTEIVML 429

  Fly   418 IVGNNVSYSGLNNHMFNSQLRKQSAQFHGQDGFGSGYGSRISIAATQSDSRRRRRRGVGGTSGGH 482
            ...|..|.|.:.:..|..:|.|:                           .:|.....||     
Mouse   430 NPANTRSISNMTSQEFVEKLTKR---------------------------LKRHPEETGG----- 462

  Fly   483 LFPEAISQYAPQTYDAVWAIALALRAAEEHWRRNEEQSKLDGFDYTRSDMAWEFLQQMGKLHFLG 547
                  .|.||..|||:||:||||........|:  ..:|:.|:|....:..:..:.|....|.|
Mouse   463 ------FQEAPLAYDAIWALALALNKTSGGGGRS--GVRLEDFNYNNQTITDQIYRAMNSSSFEG 519

  Fly   548 VSGPVSF--SGPDRVGTTAFYQIQRGLLEPVALYYPATDALDFRCPRCRPVKWHSGQVPIAKRVF 610
            |||.|.|  || .|:..|...|:|.|..:.:..|....|.|.:    .:..||..|..|..:.:.
Mouse   520 VSGHVVFDASG-SRMAWTLIEQLQGGSYKKIGYYDSTKDDLSW----SKTDKWIGGSPPADQTLV 579

  Fly   611 KLRVATIAPLAFYTIATLSSVGIALAIAFLAFNLHFRKLKAIKLSSPKLSNITAVGCIFVYATVI 675
            ......::...|.:::.|||:||.||:..|:||::...::.|:.|.|.|:|:|||||....|.|.
Mouse   580 IKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVF 644

  Fly   676 LLGLDHSTLPSAEDSFATVCTARVYLLSAGFSLAFGSMFAKTYRVHRIFTRTGSVFKD------K 734
            .||||...:  ....|..||.||::||..||||.:||||.|.:.||.:||:     |:      |
Mouse   645 PLGLDGYHI--GRSQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTK-----KEEKKEWRK 702

  Fly   735 MLQDIQLILLVGGLLLVDALLVTLWVVTDPMERHLHNLTLEISATDRSVVYQPQVEVCRSQHTQT 799
            .|:..:|...||.|:.:|.|.:.:|.:.||:.|.:.....|....|..|...||:|.|.|:...|
Mouse   703 TLEPWKLYATVGLLVGMDILTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSKKMNT 767

  Fly   800 WLSVLYAYKGLLLVVGVYMAWETRHVKIPALNDSQYIGVSVYSVVITSAIVVVLANLISERVTLA 864
            ||.:.|.||||||::|:::|:||:.|....:||.:.:|:::|:|.:...|...:..::|.:...|
Mouse   768 WLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAA 832

  Fly   865 FITITALILTSTTATLCLLFIPKLHDIWARNDIIDPVIHSMGLKMECNTRRFVVDDRRELQYRVE 929
            |...:..|:.|:..||.:||:||:..:..|.:.......:|......|      ::..|....:|
Mouse   833 FAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTN------NNEEEKSRLLE 891

  Fly   930 VQNRVYKKEIQALDAEIRKLERLLES 955
            .:||..:|.|...:..:.:|...|:|
Mouse   892 KENRELEKIIAEKEERVSELRHQLQS 917

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 132/442 (30%)
ANF_receptor 174..568 CDD:279440 120/402 (30%)
7tm_3 633..889 CDD:278433 95/262 (36%)
Gabbr1NP_062312.3 Sushi 106..156 CDD:278512 5/29 (17%)
PBP1_GABAb_receptor 170..562 CDD:107361 132/447 (30%)
ANF_receptor 186..542 CDD:279440 120/404 (30%)
7tm_3 602..856 CDD:278433 95/261 (36%)
Ax_dynein_light <884..926 CDD:287215 9/35 (26%)
Interaction with ATF4. {ECO:0000250} 887..915 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3553
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D267884at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.