DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and GABA-B-R2

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:NP_001287456.1 Gene:GABA-B-R2 FlyBaseID:FBgn0027575 Length:1224 Species:Drosophila melanogaster

Alignment Length:1185 Identity:349/1186 (29%)
Similarity:554/1186 (47%) Gaps:201/1186 (17%)


  Fly   163 TSRGPRPDGLSELGAATMAVEHINRK-RLLPGYTLELVTNDTQCDPGVGVDRFFHAIYTQPSTRM 226
            |.||..|       :..:|:.|:|.. ::|..|.|.:..|||||:..|||..||..:::.|:  .
  Fly    48 TGRGVMP-------SVKLALGHVNEHGKILANYRLHMWWNDTQCNAAVGVKSFFDMMHSGPN--K 103

  Fly   227 VMLLGSACSEVTESLAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSSHNPARIAFIRK 291
            |||.|:||:.||:.:||...:|::.|:|:..|.|..: :..||.|:|.|..:::.|..|:|.:::
  Fly   104 VMLFGAACTHVTDPIAKASKHWHLTQLSYADTHPMFT-KDAFPNFFRVVPSENAFNAPRLALLKE 167

  Fly   292 FGWGTVTTFSQNEEVHSLAVNNLVTELEAANISCAATITFAATDFKEQLLLLRETDTRIIIGSFS 356
            |.|..|.|..|||..:||..|::|.:|:|..:....|.:| ..|..|.|..|||.|.|||:|:|:
  Fly   168 FNWTRVGTVYQNEPRYSLPHNHMVADLDAMEVEVVETQSF-VNDVAESLKKLREKDVRIILGNFN 231

  Fly   357 QELAPQILCEAYRLRMFGADYAWILHESMGAPWW-PDQRTACSNHELQLAVENLIVVSTHNSIVG 420
            :..|.:..||||:|.|:|..|.|::..:....|| ..|.:.||..|:..|:|..|:|........
  Fly   232 EHFARKAFCEAYKLDMYGRAYQWLIMATYSTDWWNVTQDSECSVEEIATALEGAILVDLLPLSTS 296

  Fly   421 NNVSYSGLNNHMF---NSQLR-KQSAQFHGQDGFGSGYGSRISIAATQSDSRRRRRRGVGGTSGG 481
            .:::.:|:....:   ..:|| .:.::|||                                   
  Fly   297 GDITVAGITADEYLVEYDRLRGTEYSRFHG----------------------------------- 326

  Fly   482 HLFPEAISQYAPQTYDAVWAIALALRAAEEHWRRNEEQSKLDGFDYTRSDMAWE--FLQQMGKLH 544
                        .|||.:||.|||::...|     :.:..|..|||...|  ||  ||:.:....
  Fly   327 ------------YTYDGIWAAALAIQYVAE-----KREDLLTHFDYRVKD--WESVFLEALRNTS 372

  Fly   545 FLGVSGPVSFSGPDRVGTTAFYQIQRGLLEPVALYYPATDALDFRCPRCRPVKWHSGQVPIAKRV 609
            |.||:|||.|...:|.......|.|.|.:|.:..|:.....||....  :||||.....|..:.:
  Fly   373 FEGVTGPVRFYNNERKANILINQFQLGQMEKIGEYHSQKSHLDLSLG--KPVKWVGKTPPKDRTL 435

  Fly   610 FKLRVATIAPLAFYTIATLSSVGIALAIAFLAFNLHFRKLKAIKLSSPKLSNITAVGCIFVYATV 674
            ..:..:.:.|..:...|:.|.:|:.:|..|||||:.:|..:.||:|||.|:|:..|||:..|.::
  Fly   436 IYIEHSQVNPTIYIVSASASVIGVIIATVFLAFNIKYRNQRYIKMSSPHLNNLIIVGCMMTYLSI 500

  Fly   675 ILLGLDHSTLPSAEDSFATVCTARVYLLSAGFSLAFGSMFAKTYRVHRIFTRTGSVFKDKMLQDI 739
            |.|||| :||.|.. :|..:||||.::|.|||||:||:||:||:|||.||  |......|:::|.
  Fly   501 IFLGLD-TTLSSVA-AFPYICTARAWILMAGFSLSFGAMFSKTWRVHSIF--TDLKLNKKVIKDY 561

  Fly   740 QLILLVGGLLLVDALLVTLWVVTDPMERH------LHNLTLEISATDRSVVYQPQVEVCRSQHTQ 798
            ||.::||.||.:|..::|.|.:.||..|.      ||:..::      .|:..|:.|.|:|:|..
  Fly   562 QLFMVVGVLLAIDIAIITTWQIADPFYRETKQLEPLHHENID------DVLVIPENEYCQSEHMT 620

  Fly   799 TWLSVLYAYKGLLLVVGVYMAWETRHVKIPALNDSQYIGVSVYSVVITSAIVVVLANLISERVTL 863
            .::|::|||||||||.|.::|||||||.|||||||::||.|||:|.||......::.::|:|..|
  Fly   621 IFVSIIYAYKGLLLVFGAFLAWETRHVSIPALNDSKHIGFSVYNVFITCLAGAAISLVLSDRKDL 685

  Fly   864 AFITITALILTSTTATLCLLFIPKLHDIWA---RN--DIIDPVIHSMGLKMECNTRRFVVDDRR- 922
            .|:.::..|:..|||||||:|:||:..:..   ||  .::|..:.:....|..|.||    |.. 
  Fly   686 VFVLLSFFIIFCTTATLCLVFVPKVRLVLVELKRNPQGVVDKRVRATLRPMSKNGRR----DSSV 746

  Fly   923 -ELQYRV-EVQN---RVYK------KEIQALDAEIRKL---ERLLESGLTTTSTTTSSSTSLLTG 973
             ||:.|: :|:|   |..|      .|:|||   ||||   .|....|:|.|..:..        
  Fly   747 CELEQRLRDVKNTNCRFRKALMEKENELQAL---IRKLGPEARKWIDGVTCTGGSNV-------- 800

  Fly   974 GGHLKP------------------------ELTVTSGISQTPAASKNRTPSISGILPNLLLSVLP 1014
            |..|:|                        |:|....::.|.....|   |...:...::...||
  Fly   801 GSELEPILNDDIVRLSAPPVRREMPSTTVTEMTSVDSVTSTHVEMDN---SFVSVQSTVMAPSLP 862

  Fly  1015 P------VIPRASWPSAEYMQIPMRRSVT--FASQPQLEEACLPAQDLINLRLAHQQATEAKTGL 1071
            |      ::...|...|..|..|:::.:.  .....|:::..|..|....::...||.......|
  Fly   863 PKKKKQSIVEHHSHAPAPTMMQPIQQQLQQHLQQHQQMQQQHLQQQQHQQMQQQQQQQQHHHRHL 927

  Fly  1072 INRLRGIFSRTTSSNKGSTASLADQKG---LKAAFKSHMGLFTRLIPS-SQTASCNAIYNNPNQD 1132
              ..|...|..|..|.||..|.|.::.   ..:..:......:|...| |||.:....|::.:::
  Fly   928 --EKRNSVSAQTDDNIGSITSTAGKRSGGDCSSMRERRQSTASRHYDSGSQTPTARPKYSSSHRN 990

  Fly  1133 SIPSEASSHPNGNHLKPIHRGS---LTKSGTHLDHLTKD------PNFLPIPTISGGEQGD-QTL 1187
            |..:.::|....:::.|..:.|   :.|:.|..||....      .||:    :|..:..| .||
  Fly   991 SSTNISTSQSELSNMCPHSKPSTPAVIKTPTASDHRRTSMGSALKSNFV----VSQSDLWDTHTL 1051

  Fly  1188 GGKYVKLLETKVNFQLPSN--------------RRPSVVQQPPSLRERVRGSPRFPHRILPPTCS 1238
              .:.|..::..|:..|..              ...|.:|:..|.:.|.:..|: |.:  ...|.
  Fly  1052 --SHAKQRQSPRNYASPQRCAEHHGGHGMTYDPNTTSPIQRSVSEKNRNKHRPK-PQK--GTVCQ 1111

  Fly  1239 LSALAESE-DRPGDS 1252
            ....:|.| |.|.:|
  Fly  1112 SETDSERERDPPPNS 1126

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 130/435 (30%)
ANF_receptor 174..568 CDD:279440 120/402 (30%)
7tm_3 633..889 CDD:278433 119/262 (45%)
GABA-B-R2NP_001287456.1 PBP1_GABAb_receptor 32..418 CDD:107361 130/435 (30%)
ANF_receptor 52..396 CDD:279440 121/409 (30%)
7tm_3 459..712 CDD:278433 119/263 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D267884at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10519
RoundUp 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.