DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and gabbr1a

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:XP_694497.5 Gene:gabbr1a ZFINID:ZDB-GENE-030904-5 Length:988 Species:Danio rerio

Alignment Length:944 Identity:268/945 (28%)
Similarity:433/945 (46%) Gaps:162/945 (17%)


  Fly   152 KIVLLGLFELSTSRGPRPDGLSELGAATMAVEHI-NRKRLLPGYTLELVTNDTQCDPGVGVDRFF 215
            |:.:..||.:|   |..|.|.:.|.||.||::.: ||..:||.|.|||:..|:.||||......:
Zfish   166 KLYIGALFPMS---GGWPGGQACLPAAQMALDLVNNRSDILPDYELELIHYDSMCDPGEATKLLY 227

  Fly   216 HAIYTQPSTRMVMLLGSACSEVTESLAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSS 280
            ..:||:| .::|::.|  ||.|:..:|:....||::..|:||:|||||:|:.||.|:||....:.
Zfish   228 DLLYTEP-IKIVLMPG--CSSVSTLVAEAARMWNLIVFSYGSSSPALSNRQRFPTFFRTHPSATL 289

  Fly   281 HNPARIAFIRKFGWGTVTTFSQNEEVHSLAVNNLVTELEAANISCAATITFAATDFKEQLLLLRE 345
            |||.|:...:|:.|..:.|..|..||.:..:::|...::.|||..:...:| .||....:..|:.
Zfish   290 HNPTRVRLFQKWEWTKIATIQQTTEVFTSTLDDLEERVKEANIEISVRQSF-LTDPAVAVKNLKR 353

  Fly   346 TDTRIIIGSFSQELAPQILCEAYRLRMFGADYAWILHESMGAPWWPDQRTACSNHELQLAVENL- 409
            .|.|||:|.|.:..|.::.||.::.:::|..|.|.|   :|  |:.|......:..:...|||: 
Zfish   354 QDARIIVGLFYETEARKVFCEVFKEKLYGKKYVWFL---IG--WYADNWFKIKDPAINCTVENMT 413

  Fly   410 ----------IVVSTHNSIVGNNVSYSGLNNHMFNSQLRKQSAQFHGQDGFGSGYGSRISIAATQ 464
                      ||:....::.|    .|.|.:..|.:||..:                        
Zfish   414 EAVEGHITTEIVMLNPETVRG----ASNLTSQEFIAQLMSR------------------------ 450

  Fly   465 SDSRRRRRRGVGGTSGGHLFPEAIS--QYAPQTYDAVWAIALALRAA-----EEHWRRNEEQSKL 522
                      :||.:     ||...  |.||..||||||:||||...     .:.|       .|
Zfish   451 ----------LGGKN-----PEETGGFQEAPLAYDAVWALALALNKTVAPLRAKGW-------GL 493

  Fly   523 DGFDYTRSDMAWEFLQQMGKLHFLGVSGPVSFSGP-DRVGTTAFYQIQRGLLEPVALYYPATDAL 586
            :.|:|...::..|..:.:....|.||||.|.|... .|:..|...|:|.|..:.:. ||.:|.. 
Zfish   494 EDFNYNNKEITAEIYRALNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIG-YYDSTKG- 556

  Fly   587 DFRCPRCRPVKWHS-----GQVPIA--KRVFKLRVATIAPLAFYTIATLSSVGIALAIAFLAFNL 644
                    .:.|:.     |..|.|  .:|.| ....::...|.:::..:.:||.|.|..|:||:
Zfish   557 --------NLSWYGNDKWIGLSPPADQTKVIK-EFRYLSQKLFVSVSVFAGLGILLGIVCLSFNI 612

  Fly   645 HFRKLKAIKLSSPKLSNITAVGCIFVYATVILLGLDHSTLPSAEDSFATVCTARVYLLSAGFSLA 709
            :...::.|:.|.|.|:|:|||||:...|.|..||:|  .|......|..||..|::||..|||||
Zfish   613 YNSSVRYIQNSQPYLNNMTAVGCVLALAAVFPLGID--GLHVRRSQFPVVCQFRLWLLGLGFSLA 675

  Fly   710 FGSMFAKTYRVHRIFTRTGSVFKD------KMLQDIQLILLVGGLLLVDALLVTLWVVTDPMERH 768
            :||||.|.:.||.:||:     ||      |.|:..:|...|..||.:|.|.:.:|.:.||:...
Zfish   676 YGSMFTKIWWVHTVFTK-----KDEKKEKRKHLEPWKLYATVAVLLAIDVLSLLIWQIMDPLHIT 735

  Fly   769 LHNLTLEISATDRSVVYQPQVEVCRSQHTQTWLSVLYAYKGLLLVVGVYMAWETRHVKIPALNDS 833
            :...|.|....|..|:.||.:|.|.|:...|||.|:|.||||||::|:::|:||:.:....:||.
Zfish   736 VEQFTKEAPKEDLDVLIQPLLEHCSSKKMNTWLGVVYGYKGLLLLLGIFLAYETKSISTEKINDH 800

  Fly   834 QYIGVSVYSVVITSAIVVVLANLISERVTLAFITITALILTSTTATLCLLFIPKLHDIWARNDII 898
            :.:|:::|:|.:...|...:..::|.:...:|...:..|:.|...||.:||:||:..:..|.:..
Zfish   801 RAVGMAIYNVAVLCMITAPVTMILSSQQDASFAFASLAIIFSVYITLVVLFVPKIRRLITRGEWQ 865

  Fly   899 DPVIHSMGLKMECNTRRFVVDDRRELQYRVEVQNRVYKKEIQALDAEIRKLERLLESGLTTTSTT 963
            .....::......|..    |:.:..|  :|.:||..:|.||      .|.||:.|         
Zfish   866 SEQQDTLKTGSSTNNN----DEEKSRQ--LERENRELQKIIQ------EKEERVTE--------- 909

  Fly   964 TSSSTSLLTGGGHLKPELTVTSGISQTPAASKNRTPSISGILPNLLLSV-LPPVIPRASWPSAEY 1027
                               :.|.:::..|....|.||:..  .|...|| .|...|.:..|:.:.
Zfish   910 -------------------LRSQLAERQALRSRRRPSVQN--QNQNHSVPSPQADPPSYCPTTDK 953

  Fly  1028 MQIPMRRSVTFASQPQL--EEACLPAQDLINLRL 1059
            ..:|    .:|::...|  .|:.|...:..|.||
Zfish   954 QSMP----PSFSNSSNLYQGESKLSRNNCHNSRL 983

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 131/453 (29%)
ANF_receptor 174..568 CDD:279440 120/414 (29%)
7tm_3 633..889 CDD:278433 95/262 (36%)
gabbr1aXP_694497.5 CCP 98..155 CDD:214478
PBP1_GABAb_receptor 168..561 CDD:107361 132/465 (28%)
ANF_receptor 184..541 CDD:279440 120/416 (29%)
7tm_3 601..855 CDD:278433 95/261 (36%)
Ax_dynein_light <883..925 CDD:287215 14/78 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D267884at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.