DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and GABA-B-R1

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:NP_001246033.1 Gene:GABA-B-R1 FlyBaseID:FBgn0260446 Length:841 Species:Drosophila melanogaster

Alignment Length:870 Identity:254/871 (29%)
Similarity:430/871 (49%) Gaps:93/871 (11%)


  Fly   157 GLFELSTSRGPRPDGLSELGAATMAVEHINRK-RLLPGYTLELVTNDTQCDPGVGVDRFFHAIYT 220
            |:|.:: .:|....|.:.:.||.:|::.:|:: .||||:.|.|.:||::|:||:|....::.:|.
  Fly    37 GIFPIA-GKGGWQGGQACMPAARLALDDVNKQPNLLPGFKLILHSNDSECEPGLGASVMYNLLYN 100

  Fly   221 QPSTRMVMLLGSACSEVTESLAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSSHNPAR 285
            :|. ::::|.|  ||.|..::|:....||::.:.:|::|||||||:.||..:||....:.|||.|
  Fly   101 KPQ-KLMLLAG--CSTVCTTVAEAAKMWNLIVLCYGASSPALSDRKRFPTLFRTHPSATVHNPTR 162

  Fly   286 IAFIRKFGWGTVTTFSQNEEVHSLAVNNLVTELEAANISCAATITFAATDFKEQLLLLRETDTRI 350
            |..::||||..|....|.|||....|.:|......|.:......:| .:|..:.:..||..|.||
  Fly   163 IKLMKKFGWSRVAILQQAEEVFISTVEDLENRCMEAGVEIVTRQSF-LSDPTDAVRNLRRQDARI 226

  Fly   351 IIGSFSQELAPQILCEAYRLRMFGADYAWILHESMGAPWWPD---------QRTACSNHELQLAV 406
            |:|.|....|.::|||.|:.:::|..:.|..   :|  |:.|         :...|:..::::|.
  Fly   227 IVGLFYVVAARRVLCEMYKQQLYGRAHVWFF---IG--WYEDNWYEVNLKAEGITCTVEQMRIAA 286

  Fly   407 ENLIVVSTHNSIVGNNVSYSGLNNHMFNSQLRKQSAQFHGQDGFGSGYGSRISIAATQSDSRRRR 471
            |..:..........|..:.||:....|..:|.:...:        .||           |....|
  Fly   287 EGHLTTEALMWNQNNQTTISGMTAEEFRHRLNQALIE--------EGY-----------DINHDR 332

  Fly   472 RRGVGGTSGGHLFPEAISQYAPQTYDAVWAIALALRAAEEHWRRNEEQSKLDGFDYTRSDMAWEF 536
                        :||.. |.||..|||||::|||.....|  |....:..|..|.||..::|.|.
  Fly   333 ------------YPEGY-QEAPLAYDAVWSVALAFNKTME--RLTTGKKSLRDFTYTDKEIADEI 382

  Fly   537 LQQMGKLHFLGVSGPVSFSGP-DRVGTTAFYQIQRGLLEPVALYYPATDALDFRCPRCRPVKWHS 600
            ...|....||||||.|:||.. ||:..|...|:..|..|.:..|....|.|.:    ....:|..
  Fly   383 YAAMNSTQFLGVSGVVAFSSQGDRIALTQIEQMIDGKYEKLGYYDTQLDNLSW----LNTEQWIG 443

  Fly   601 GQVPIAKRVFKLRVATIAPLAFYTIATLSSVGIALAIAFLAFNLHFRKLKAIKLSSPKLSNITAV 665
            |:||..:.:....:.|::...|..:.|:||.||.:|.|.:.||:..:..:.|:.|.|..:.|...
  Fly   444 GKVPQDRTIVTHVLRTVSLPLFVCMCTISSCGIFVAFALIIFNIWNKHRRVIQSSHPVCNTIMLF 508

  Fly   666 GCIFVYATVILLGLDHSTLPSAEDSFATVCTARVYLLSAGFSLAFGSMFAKTYRVHRIFTRTGSV 730
            |.|....:|||||:|...:  :.:.:..:|.||.:|||.||:||:|:||:|.:|||| ||.....
  Fly   509 GVIICLISVILLGIDGRFV--SPEEYPKICQARAWLLSTGFTLAYGAMFSKVWRVHR-FTTKAKT 570

  Fly   731 FKDKMLQDIQLILLVGGLLLVDALLVTLWVVTDPMERHLHNLTLE--ISATDRSVVYQPQVEVCR 793
            ...|.::..:|..:|.|||.:|.:::..|.:.||::|:|....||  :|.|| .:..:|::|.|.
  Fly   571 DPKKKVEPWKLYTMVSGLLSIDLVILLSWQIFDPLQRYLETFPLEDPVSTTD-DIKIRPELEHCE 634

  Fly   794 SQHTQTWLSVLYAYKGLLLVVGVYMAWETRHVKIPALNDSQYIGVSVYSVVITSAIVVVLANLIS 858
            ||....||.::|.:|||:||.|:::|:|||.:|:..:|||:|:|:|:|:||:...|...:..:|:
  Fly   635 SQRNSMWLGLVYGFKGLILVFGLFLAYETRSIKVKQINDSRYVGMSIYNVVVLCLITAPVGMVIA 699

  Fly   859 ERVTLAFITITALILTSTTATLCLLFIPKLHDIWARNDIIDPVIHSMG-LKMECNTRRFVVDDRR 922
            .:...:|..:...::.....::.|:|:||         :|:.:.|... .:.:.|....:..:..
  Fly   700 SQQDASFAFVALAVIFCCFLSMLLIFVPK---------VIEVIRHPKDKAESKYNPDSAISKEDE 755

  Fly   923 ELQYRVEVQNRVYKKEIQALDAEIRKL-ERLLESG-------------LTTTSTTTSSSTSLLTG 973
            |...::..:|...::.|...:.:||.| :||:|.|             .:....|||...||:..
  Fly   756 ERYQKLVTENEELQRLITQKEEKIRVLRQRLVERGDAKGTELNGATGVASAAVATTSQPASLINS 820

  Fly   974 GGHLKPELTVTSGISQTPAASKNRT 998
            ..|..|..|    ::.|....::||
  Fly   821 SAHATPAAT----LAITQDTHEHRT 841

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 131/444 (30%)
ANF_receptor 174..568 CDD:279440 122/405 (30%)
7tm_3 633..889 CDD:278433 89/258 (34%)
GABA-B-R1NP_001246033.1 PBP1_GABAb_receptor 34..437 CDD:107361 131/448 (29%)
ANF_receptor 52..415 CDD:279440 122/406 (30%)
7tm_3 476..730 CDD:278433 89/267 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3553
OrthoDB 1 1.010 D267884at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10519
RoundUp 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.