DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and Gpr156

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:NP_695207.1 Gene:Gpr156 RGDID:708438 Length:792 Species:Rattus norvegicus

Alignment Length:783 Identity:177/784 (23%)
Similarity:299/784 (38%) Gaps:144/784 (18%)


  Fly   614 VATIAPLAFYTIATLSSVGIALAIAFLAFNLHFRKLKAIKLSSPKLSNITAVGCIFVYATVILLG 678
            ::.::|.....|.|..|.|:.|.:.||||.:..||.:.:|:|||.|:.:|.:|....|::..|.|
  Rat    42 ISPLSPALLGVIWTFLSCGLLLVLFFLAFTIRCRKNRIVKMSSPNLNIVTLLGSCLTYSSAYLFG 106

  Fly   679 LDHSTLPSAEDSFATVCTARVYLLSAGFSLAFGSMFAKTYRVHRIFTRTGSVFKDK--MLQDIQL 741
            :..:.:.|   |...:...|:.||..|.:|.||.:..|::|::::||:.   ..||  :::|:||
  Rat   107 IQDALVGS---SVEALIQTRLSLLCIGTTLVFGPILGKSWRLYKVFTQR---VPDKRVIIKDLQL 165

  Fly   742 ILLVGGLLLVDALLVTLWVVTDPMERHLHNLTLEISATDRSVVYQ-PQVEVCRSQHTQTWLSVLY 805
            :.||..|::.|.:|:..||:|||:: .|..|.:.:..|.|.|... .....|.|:::..|::::.
  Rat   166 LGLVAALVVADVILLVTWVLTDPIQ-CLQILGVSMKVTGRDVSCSLTNTHFCASRYSDVWIALVL 229

  Fly   806 AYKGLLLVVGVYMAWETRHVKIPALNDSQYIGVSVYSVVITSAIVVVLANLISERVTLAFITITA 870
            ..|||||:.|.|:|..|.||..|.:|.|..|.|.|..:::|:.::.|:...:.....|.|...:.
  Rat   230 GCKGLLLLYGAYLAGLTNHVSSPPVNQSLTIMVGVNLLLLTAGLLFVVTRYLHSWPNLVFGLTSG 294

  Fly   871 LILTSTTATLCLLFIPKLHDIWA---RNDIIDPVIHSMGLKMECNTRRFVVDDRRELQYRVEVQN 932
            .|...||...|.:|:|:|....|   .|..|..:........:....:|..|....|:.. ....
  Rat   295 GIFVCTTTVNCCVFLPQLRQRKAFEGENQTIRHMAKYFSTPSKTFRSKFDEDQSCHLRDEXSCME 359

  Fly   933 RVYKKE---IQALDAEI----RKLERLL-------------------------------ESGLTT 959
            |:..::   |::|..::    .||.:|:                               |||...
  Rat   360 RLLTEKNAVIESLQEQVSNAKEKLVKLMSAECALDSPEWAVPAAASAGGPAECXATSEKESGAAA 424

  Fly   960 TSTTTSSSTSL-LTGGGHLKPELT-----------------VTSGISQTPAASKNRTPS------ 1000
            ..:..:|:.|. :.|.|..:.: :                 :..|.||.|.|.::..|.      
  Rat   425 EDSLPASAASQHMQGPGASRRDXSPSPDQKYDMPLKQFCDHLDMGCSQKPKAEQSEGPERGNQEP 489

  Fly  1001 --------ISGIL-----PNLLLSVLPPVIPRASWPSAEYMQIPMRRSVTFASQPQLEEACLPAQ 1052
                    ..|:.     |.....|||..:||.|....|.:| .:.:.:...::..|.....|.|
  Rat   490 MAPGQSLMTDGVACEPHRPRQNSEVLPERLPRVSSVVREKLQ-EVLQELDLGTEAPLSPLPCPQQ 553

  Fly  1053 D-LINLRLAHQQATEAKTGL---INRLRGIFSRTTSSNKGSTASLADQKGLKAAFKSHMGLFTRL 1113
            . ..|...:.|:.:.:|.|.   :.|.|....|..|...||.......:.......|..||..:.
  Rat   554 PWKSNTSGSPQKLSPSKLGFSPYVVRRRRAAQRARSRIPGSVGLKMGHQANNTVSGSQNGLIVQN 618

  Fly  1114 IPSSQTASCNAIYNNPNQDSIPSEASSHPNGNHLKPIHRGSLTKSGTHLDHLTKDPN-------- 1170
            ..|.:....||....|...|:.....|.|:.      .||||..|    .....:|.        
  Rat   619 RDSPRLDHHNARSKEPRSSSVKPSPISAPHQ------RRGSLEGS----KQCETEPQEARGYSVA 673

  Fly  1171 FLPIPTISGGEQGDQTLGGKYVKLLETKVNFQLPSNRRPSVVQQP--PSLR-------ERVRGSP 1226
            |...|:.|...|...      ...|.: .  .||..|:|..:..|  |||.       .....|.
  Rat   674 FPRQPSASAPAQSST------APCLSSXP--ALPRQRQPLPLLSPGCPSLSSGCYNLDSESSSSD 730

  Fly  1227 RFPHRILPPTCSL---SALAESEDRPGDSTSILGSCKSIPRISLQQATSGGTWKSMETAGKSRLS 1288
            .|..|...|.|.:   |:|..::....||             .|:|.:...:|:.:....|..::
  Rat   731 EFFCRCHRPYCEICFQSSLDSNDSDTSDS-------------DLEQTSGLASWEKLLARSKPVVN 782

  Fly  1289 LGD 1291
            ..|
  Rat   783 FKD 785

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361
ANF_receptor 174..568 CDD:279440
7tm_3 633..889 CDD:278433 81/259 (31%)
Gpr156NP_695207.1 7tm_3 71..>141 CDD:278433 21/73 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10519
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.