DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and GABBR1

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:XP_005249039.1 Gene:GABBR1 HGNCID:4070 Length:966 Species:Homo sapiens

Alignment Length:871 Identity:260/872 (30%)
Similarity:418/872 (48%) Gaps:97/872 (11%)


  Fly   100 RLNSHSNLPGSTNASHAHHLLNLPPRQRYLKVNQVFESERRMSPAEMQRNHGKIVLLG-LFELST 163
            |.:...:|.||:.:..:....:.|  :.:.:||:...||||            .|.:| ||.:| 
Human   135 RCDPDFHLVGSSRSICSQGQWSTP--KPHCQVNRTPHSERR------------AVYIGALFPMS- 184

  Fly   164 SRGPRPDGLSELGAATMAVEHINRKR-LLPGYTLELVTNDTQCDPGVGVDRFFHAIYTQPSTRMV 227
              |..|.|.:...|..||:|.:|.:| :||.|.|:|:.:|::||||......:..:|..| .:::
Human   185 --GGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDP-IKII 246

  Fly   228 MLLGSACSEVTESLAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSSHNPARIAFIRKF 292
            ::.|  ||.|:..:|:....||::.:|:||:|||||:|:.||.|:||....:.|||.|:....|:
Human   247 LMPG--CSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKW 309

  Fly   293 GWGTVTTFSQNEEVHSLAVNNLVTELEAANISCAATITFAATDFKEQLL---LLRETDTRIIIGS 354
            ||..:.|..|..||.:..:::|...::.|.|.    |||..:.|.:..:   .|:..|.|||:|.
Human   310 GWKKIATIQQTTEVFTSTLDDLEERVKEAGIE----ITFRQSFFSDPAVPVKNLKRQDARIIVGL 370

  Fly   355 FSQELAPQILCEAYRLRMFGADYAWILHESMGAPWWP--DQRTACSNHELQLAVENLIVVSTHNS 417
            |.:..|.::.||.|:.|:||..|.|.|.......|:.  |....|:..|:..|||..|.......
Human   371 FYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVML 435

  Fly   418 IVGNNVSYSGLNNHMFNSQLRKQSAQFHGQDGFGSGYGSRISIAATQSDSRRRRRRGVGGTSGGH 482
            ...|..|.|.:.:..|..:|.|:                           .:|.....||     
Human   436 NPANTRSISNMTSQEFVEKLTKR---------------------------LKRHPEETGG----- 468

  Fly   483 LFPEAISQYAPQTYDAVWAIALALRAAEEHWRRNEEQSKLDGFDYTRSDMAWEFLQQMGKLHFLG 547
                  .|.||..|||:||:||||........|:  ..:|:.|:|....:..:..:.|....|.|
Human   469 ------FQEAPLAYDAIWALALALNKTSGGGGRS--GVRLEDFNYNNQTITDQIYRAMNSSSFEG 525

  Fly   548 VSGPVSF--SGPDRVGTTAFYQIQRGLLEPVALYYPATDALDFRCPRCRPVKWHSGQVPIAKRVF 610
            |||.|.|  || .|:..|...|:|.|..:.:..|....|.|.:    .:..||..|..|..:.:.
Human   526 VSGHVVFDASG-SRMAWTLIEQLQGGSYKKIGYYDSTKDDLSW----SKTDKWIGGSPPADQTLV 585

  Fly   611 KLRVATIAPLAFYTIATLSSVGIALAIAFLAFNLHFRKLKAIKLSSPKLSNITAVGCIFVYATVI 675
            ......::...|.:::.|||:||.||:..|:||::...::.|:.|.|.|:|:|||||....|.|.
Human   586 IKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVF 650

  Fly   676 LLGLDHSTLPSAEDSFATVCTARVYLLSAGFSLAFGSMFAKTYRVHRIFTRTGSVFKD------K 734
            .||||...:  ..:.|..||.||::||..||||.:||||.|.:.||.:||:     |:      |
Human   651 PLGLDGYHI--GRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTK-----KEEKKEWRK 708

  Fly   735 MLQDIQLILLVGGLLLVDALLVTLWVVTDPMERHLHNLTLEISATDRSVVYQPQVEVCRSQHTQT 799
            .|:..:|...||.|:.:|.|.:.:|.:.||:.|.:.....|....|..|...||:|.|.|:...|
Human   709 TLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNT 773

  Fly   800 WLSVLYAYKGLLLVVGVYMAWETRHVKIPALNDSQYIGVSVYSVVITSAIVVVLANLISERVTLA 864
            ||.:.|.||||||::|:::|:||:.|....:||.:.:|:::|:|.:...|...:..::|.:...|
Human   774 WLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAA 838

  Fly   865 FITITALILTSTTATLCLLFIPKLHDIWARNDIIDPVIHSMGLKMECNTRRFVVDDRRELQYRVE 929
            |...:..|:.|:..||.:||:||:..:..|.:.......:|......|      ::..|....:|
Human   839 FAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTN------NNEEEKSRLLE 897

  Fly   930 VQNRVYKKEIQALDAEIRKLERLLES 955
            .:||..:|.|...:..:.:|...|:|
Human   898 KENRELEKIIAEKEERVSELRHQLQS 923

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 132/442 (30%)
ANF_receptor 174..568 CDD:279440 120/402 (30%)
7tm_3 633..889 CDD:278433 95/262 (36%)
GABBR1XP_005249039.1 Sushi 112..162 CDD:278512 5/29 (17%)
PBP1_GABAb_receptor 176..568 CDD:107361 132/447 (30%)
ANF_receptor 192..548 CDD:279440 120/404 (30%)
7tm_3 608..862 CDD:278433 95/261 (36%)
Ax_dynein_light <890..932 CDD:287215 9/35 (26%)
cNMPbd_u2 <927..>951 CDD:293249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D267884at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.