DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and Gabbr2

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:NP_001074610.1 Gene:Gabbr2 MGIID:2386030 Length:940 Species:Mus musculus

Alignment Length:953 Identity:284/954 (30%)
Similarity:447/954 (47%) Gaps:160/954 (17%)


  Fly   155 LLGLFELSTSRGPRPDGLSELGAATMAVEHINRKRLLPGYTLELVTNDTQCDPGVGVDRFFHAIY 219
            ::||..|:........|...|.|..:|:|.|..:.||..|.|:|...||:||...|:..|:.||.
Mouse    57 IMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIK 121

  Fly   220 TQPSTRMVMLLGSACSEVTESLAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSSHNPA 284
            ..|:  .:|:.|..|..||..:|:.:..||:||:||.:|:|.|:|::::|||:|||..|::.|||
Mouse   122 YGPN--HLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPA 184

  Fly   285 RIAFIRKFGWGTVTTFSQNEEVHSLAVNNLVTELEAANISCAATITFA---ATDFKEQLLLLRET 346
            .:..::.|.|..|.|.:|:.:..|...|:|...|...:|..:.|.:|:   .|..|:    |:..
Mouse   185 ILKLLKHFRWRRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKK----LKGN 245

  Fly   347 DTRIIIGSFSQELAPQILCEAYRLRMFGADYAWILHESMGAPWWPD-----QRTACSNHELQLAV 406
            |.|||:|.|.|.:|.::.|.|:...|||:.|.||:.......||..     ..:.|....|..|:
Mouse   246 DVRIILGQFDQNMAAKVFCCAFEESMFGSKYQWIIPGWYEPAWWEQVHVEANSSRCLRRSLLAAM 310

  Fly   407 ENLIVVSTHNSIVGNNVSYSGLNNHMFNSQLRKQSAQFHGQDGFGSGYGSRISIAATQSDSRRRR 471
            |..|           .|.:..|::....:...|...|:..:      |.|              :
Mouse   311 EGYI-----------GVDFEPLSSKQIKTISGKTPQQYERE------YNS--------------K 344

  Fly   472 RRGVGGTSGGHLFPEAISQYAPQTYDAVWAIALALRAAEEHWRRNEEQSKLDGFDYTRSDMAWEF 536
            |.|||        |.....||   ||.:|.||..|:.|.|....:....::..|:||...:....
Mouse   345 RSGVG--------PSKFHGYA---YDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRII 398

  Fly   537 LQQMGKLHFLGVSGPVSFSGPDRVGTTAFYQIQRGLLEPVALYYPATDALDFRCPRCRPVKWHSG 601
            |..|.:.:|.||:|.|.|...:|:||..|.|.|......|..|....|.|:....   .:::...
Mouse   399 LNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIIND---TIRFQGS 460

  Fly   602 QVPIAKRVFKLRVATIAPLAFYTIATLSSVGIALAIAFLAFNLHFRKLKAIKLSSPKLSNITAVG 666
            :.|..|.:...::..|:...:..::.|:.:|:.:|.|||.||:..|..|.||:|||.::|:..:|
Mouse   461 EPPKDKTIILEQLRKISLPLYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILG 525

  Fly   667 CIFVYATVILLGLDHSTLPSAEDSFATVCTARVYLLSAGFSLAFGSMFAKTYRVHRIFTRTGSVF 731
            .:..||::.|.|||.|.:  :|.:|.|:||.|.::|:.|::.|||:|||||:|||.||...  ..
Mouse   526 GMLSYASIFLFGLDGSFV--SEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNV--KM 586

  Fly   732 KDKMLQDIQLILLVGGLLLVDALLVTLWVVTDPMERHLHNLTLEISATDRSVVYQPQVEVCRSQH 796
            |.|:::|.:|:::|||:||:|..::..|...||:.|.:...::|.....|.:..:|.:|.|.:.|
Mouse   587 KKKIIKDQKLLVIVGGMLLIDLCILICWQAVDPLRRTVERYSMEPDPAGRDISIRPLLEHCENTH 651

  Fly   797 TQTWLSVLYAYKGLLLVVGVYMAWETRHVKIPALNDSQYIGVSVYSVVITSAIVVVLANLISERV 861
            ...||.::|||||||::.|.::|||||:|.|||||||:|||:|||:|.|...|...::.|..::.
Mouse   652 MTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQP 716

  Fly   862 TLAFITITALILTSTTATLCLLFIPKLHDIWARNDIIDPVIHSMGLKMECNTRRFVVDDRRELQY 926
            .:.|..:..:|:..:|.||||:|:|||                    :...|........|..|:
Mouse   717 NVQFCIVALVIIFCSTITLCLVFVPKL--------------------ITLRTNPDAATQNRRFQF 761

  Fly   927 RVEVQNRVYKKEIQALDAEIRKLERLLESGLTTTSTTT--SSSTSLLTG----GGHLKPELT--- 982
               .||:  |||    |::            |:||.|:  .:|||.|.|    ...|:.::|   
Mouse   762 ---TQNQ--KKE----DSK------------TSTSVTSVNQASTSRLEGLQSENHRLRMKITELD 805

  Fly   983 -----VTSGISQTPAASK-----------------NRTPSISG---ILPNLLLSVLPPVIPRASW 1022
                 ||..:..||..:.                 |.|.|..|   ||.|.|     ...|:..|
Mouse   806 KDLEEVTMQLQDTPEKTTYIKQNHYQELNDILSLGNFTESTDGGKAILKNHL-----DQNPQLQW 865

  Fly  1023 PSAEYMQ--------------IPMRRSVTFASQPQLEEACLPA 1051
            .:.|..:              |..|.|:..   |.|..|.||:
Mouse   866 NTTEPSRTCKDPIEDINSPEHIQRRLSLQL---PILHHAYLPS 905

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 129/441 (29%)
ANF_receptor 174..568 CDD:279440 120/402 (30%)
7tm_3 633..889 CDD:278433 107/256 (42%)
Gabbr2NP_001074610.1 PBP1_GABAb_receptor 57..442 CDD:107361 127/433 (29%)
7tmC_GABA-B-R2 479..748 CDD:320421 109/293 (37%)
TM helix 1 479..504 CDD:320421 8/25 (32%)
TM helix 2 516..537 CDD:320421 6/21 (29%)
TM helix 3 553..577 CDD:320421 13/24 (54%)
TM helix 4 596..616 CDD:320421 8/20 (40%)
TM helix 5 652..678 CDD:320421 14/26 (54%)
TM helix 6 687..710 CDD:320421 11/23 (48%)
TM helix 7 717..742 CDD:320421 9/25 (36%)
TIP49 785..>863 CDD:332389 18/83 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10519
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.