DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and Gpr156

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:NP_700443.2 Gene:Gpr156 MGIID:2653880 Length:798 Species:Mus musculus

Alignment Length:807 Identity:185/808 (23%)
Similarity:310/808 (38%) Gaps:192/808 (24%)


  Fly   617 IAPLAFYTIATLSSVGIALAIAFLAFNLHFRKLKAIKLSSPKLSNITAVGCIFVYATVILLGLDH 681
            ::|.....:.|..|.|:.|.:.||||.:..||.:.:|:|||.|:.:|.:|....|.:..|.|:..
Mouse    45 LSPALLGIMWTFLSCGLLLVLFFLAFTIRCRKNRIVKMSSPNLNVVTLLGSCLTYISAYLFGIQD 109

  Fly   682 STLPSAEDSFATVCTARVYLLSAGFSLAFGSMFAKTYRVHRIFTRTGSVFKDK--MLQDIQLILL 744
            :...|   |...:...|:.||..|.||.||.:..|::|::::||:.   ..||  :::|:||:.|
Mouse   110 ALEGS---SVEALIQTRLSLLCIGTSLVFGPILGKSWRLYKVFTQR---VPDKRVIIKDLQLLGL 168

  Fly   745 VGGLLLVDALLVTLWVVTDPMERHLHNLTLEISATDRSVVYQ-PQVEVCRSQHTQTWLSVLYAYK 808
            |..|::.|.:|:..||:|||:: .|..|.:.:..|.|.|... .....|.|:::..|::::...|
Mouse   169 VAALVVADVILLVTWVLTDPIQ-CLQMLGVSMKVTGRDVSCSLTNTHFCASRYSDVWIALVLGCK 232

  Fly   809 GLLLVVGVYMAWETRHVKIPALNDSQYIGVSVYSVVITSAIVVVLANLISERVTLAFITITALIL 873
            ||||:.|.|:|..|.||..|.:|.|..|.|.|..:::|:.::.|:...:.....|.|...:..|.
Mouse   233 GLLLLYGAYLAGLTNHVSSPPVNQSLTIMVGVNLLLLTAGLLFVVTRYLHSWPNLVFGLTSGGIF 297

  Fly   874 TSTTATLCLLFIPKLHDIWARNDIIDPVIHSMGLKMECNTRRF-----------VVDDRRELQYR 927
            ..||...|.:|||:|.. |...:..:..:..|.......::.|           :.|::..::..
Mouse   298 VCTTTVNCCVFIPQLKQ-WKAFEGENQTMRHMAKYFSTPSKSFHGQFDEDPSCHLRDEKSCMERL 361

  Fly   928 VEVQNRVYKKEIQALDAEI----RKLERLLESGLTTTSTTTSSSTSLLTGGGHLKPELTVTS--- 985
            :..:|.|    |::|..::    .||.:|:.:..|..|                 ||..|..   
Mouse   362 LTEKNAV----IESLQEQVSNAKEKLVKLMSAECTYDS-----------------PEWAVPDAAS 405

  Fly   986 -------GISQTPAASKNRTPSISGILPNLLLSVL--------PPVIPRASWPS-AEYMQIPMRR 1034
                   |.|:.||.|:|.    ||......|.|.        |....|.:.|| |:...:|:::
Mouse   406 ARGLALPGPSECPAVSENE----SGAAARDSLHVPAACQHVQGPGASRRDTSPSPAQQDNMPLKQ 466

  Fly  1035 SV----TFASQ-PQLE----------EACLPAQDLI--NLRLAHQQATEAKTGLINRLRGIFSRT 1082
            ..    |..:| |:.|          |...|:|.|:  .:.....:..::..||..:|.|:.|..
Mouse   467 YCDHLDTGCNQKPKAEQSEGPERGDQEPMAPSQRLMADGVACEPHKPRQSPEGLPKKLPGVSSVV 531

  Fly  1083 TSS--------NKGSTASLADQKGLKAAFKSHMGLFTRLIPSSQTASCNAIYNNP---NQDSIPS 1136
            ...        :.||.|.|:.....:..:||...      .|.|..|.:.:..:|   .:.....
Mouse   532 REKLQEVLQELDLGSEAPLSPLPCPQQLWKSTTS------RSPQKLSPSKLGFSPYVVRRRRAAQ 590

  Fly  1137 EASSH-PNGNHLKPIHRGSLTKSGT------------HLDH------LTKDPNFLPIP------- 1175
            .|.|| |....|...|:.:.|.|.:            .|||      :.:..:..|.|       
Mouse   591 RARSHIPGSVGLNVGHQANSTVSSSQSGLIVQNRDSPRLDHNNARSKVPRSSSVKPSPLSEPRRK 655

  Fly  1176 --TISGGEQGD---QTLGGKYVKLLETKVNFQLPSNRRPSVVQQPPSL-------------RERV 1222
              |:.|.:|.:   |..||        ..|...|.....||..|.|:.             :.|.
Mouse   656 QGTLEGSKQCETEPQEAGG--------ACNVAFPCQSSASVQAQSPAAPCLPSSPALPRQRQPRP 712

  Fly  1223 RGSPRFP-----------------------HRILPPTCSLSALAESEDRPGDSTSILGSCKSIPR 1264
            |.||..|                       ||.....|..|:|..::....||            
Mouse   713 RLSPGCPSLSSGCYNLDSESSSSDEFFCRCHRPYCEICFQSSLDSNDSDTSDS------------ 765

  Fly  1265 ISLQQATSGGTWKSMETAGKSRLSLGD 1291
             .|:||:...:|..:....|..::..|
Mouse   766 -DLEQASGLASWGKLWARSKPVVNFKD 791

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361
ANF_receptor 174..568 CDD:279440
7tm_3 633..889 CDD:278433 83/259 (32%)
Gpr156NP_700443.2 7tm_3 71..>141 CDD:278433 22/73 (30%)
rad18 347..>538 CDD:273165 42/216 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10519
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.