DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and gbb-2

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:NP_500579.3 Gene:gbb-2 WormBaseID:WBGene00022675 Length:842 Species:Caenorhabditis elegans

Alignment Length:934 Identity:278/935 (30%)
Similarity:436/935 (47%) Gaps:165/935 (18%)


  Fly   135 FESERRMSPAEMQRNHGKIVL-LGLFELSTSRGPRPDGLSELGAATMAVEHI-NRKRLLPGYTLE 197
            :|:...:|   .:|.||.|.| ||:|  :..:...||.|.   |...|:.|: :|..:|.||.||
 Worm    18 YEAGEELS---CKRRHGGIPLPLGVF--TVQKEGFPDALP---AIRTALSHVHSRSCILQGYRLE 74

  Fly   198 LVTNDTQCDPGVGVDRFFHAIYTQPSTRMVMLLGSACSEVTESLAKVVPYWNIVQVSFGSTSP-- 260
            ::..||.|....|:...|..|.::|  |.|.:||..|:||.|.:|..:.||.|||:|:..|..  
 Worm    75 MIVKDTHCKTSQGMKALFDLIASRP--RPVAILGGQCTEVNEPIAMALKYWQIVQLSYAETHAKF 137

  Fly   261 ALSDRRE-FPYFYRTVAPDSSHNPARIAFIRKFGWGTVTTFSQNEEV-HSLAVNNLVTELE-AAN 322
            |.||..| |..|:|.|....:.|.|:..|:..|||..|.|..||::. ::|....|.|.|| ...
 Worm   138 ASSDSHELFTTFFRVVPGSRNTNMAKCKFVNHFGWKRVGTVKQNDQPRYALPHEALTTRLEHGFG 202

  Fly   323 ISCAATITFAATDFKE------QLLLLRETDTRIIIGSFSQELAPQILCEAYRLRMFGADYAWIL 381
            :....|   |..::::      :|..|:|.|.|||:....:|:|..:||..|...|:|.:|.|||
 Worm   203 VKIVHT---AGVNWEQIETVGGELDELKERDVRIILVDVDEEMAATVLCAGYHRGMYGDNYVWIL 264

  Fly   382 HESMGAPWWPDQRTACSNHELQLAVENLIVVSTHNSIVGNNVSYSGLNNHMFNSQLRKQSAQFHG 446
            .......|.......|:..|::.|.:|      |.|                             
 Worm   265 PGYHSDKWLNQTHDNCTVEEMREAAKN------HFS----------------------------- 294

  Fly   447 QDGFGSGYGSRISIAATQSDSRRRRRRGVGGTSGGHLFPEAISQYAPQT------YDAVWAIALA 505
                       :..|.|:.|...:.   ||.|..|.::.| |:|..|..      ||.:|.:|:|
 Worm   295 -----------VEFALTRRDVDTKI---VGNTRAGDVWNE-ITQLDPNNTWRGYLYDGLWTLAIA 344

  Fly   506 LRAAEEHWRRNEEQSKLDGFDYTRSDMAWEFLQQMGKLHFLGVSGPVSFSGPDRVGTTAFYQIQR 570
            |           ..|..|..:::...|    ::.:....|.|::|.|.|:..:|:|.....|...
 Worm   345 L-----------SHSMGDNAEFSHHKM----MEAIDNSSFQGLTGKVKFANNERLGLVDIKQWSD 394

  Fly   571 GLLEPVALYYPATDALDFRCPRCRPVKWHSGQVPIAKRVFKLRVATIAPLAFYTIATLSSVGIAL 635
            |...|.|:|..|.|  :|:........|   ..|:...:.:.|...|:.:.|..::.|:.:||.|
 Worm   395 GQYVPFAVYDGADD--EFKIIDSTTKGW---SPPLDSTITERRREHISSILFLAMSLLALIGIFL 454

  Fly   636 AIAFLAFNLHFRKLKAIKLSSPKLSNITAVGCIFVYATVILLGLDHSTLPSAEDSFATVCTARVY 700
            |:.||..|..:|..:.||:|||.|:||...|.|..:|:||:||||  |...:.|.|..:|..:.:
 Worm   455 ALIFLLINFRYRNHRFIKMSSPNLNNIIIAGSICTFASVIMLGLD--TRIVSPDVFVWLCYTKTW 517

  Fly   701 LLSAGFSLAFGSMFAKTYRVHRIFTRTGSVFKD-KMLQDIQLILLVGGLLLVDALLVTLWVVTDP 764
            .|..||:|:||:||:||:|||.|||   ::..| |.::|.:|.:::|.||.:|..::..|....|
 Worm   518 TLCIGFTLSFGAMFSKTWRVHSIFT---NIRMDRKAIKDSKLFIILGILLFIDICVLVTWAFVSP 579

  Fly   765 MERHLHNLTLEISATDRSVVYQPQVEVCRSQHTQTWLSVLYAYKGLLLVVGVYMAWETRHVKIPA 829
            ..   :.:|......:.::|..|:||.|.|.|:..:.:||||.||:|:::|.::|||||||.:||
 Worm   580 FS---YTVTELPHIPEDNIVIIPEVEKCNSSHSGVFQAVLYAVKGVLMILGCFLAWETRHVNVPA 641

  Fly   830 LNDSQYIGVSVYSVVITSAIVVVLANLISERVTLAFITITALILTSTTATLCLLFIPKLHDIWAR 894
            ||||:|||.|||..|:.|.:.:..:.::.|||...|...:..::.|||.||||:|:||:.:: ||
 Worm   642 LNDSKYIGTSVYCCVVMSVLGLSTSVILQERVNEMFSLASFFVIFSTTLTLCLVFVPKVIEL-AR 705

  Fly   895 NDI-IDPVIHSMGL----------KMECNTRRFVVDDRRELQYRVEVQNR-----VYKKEIQALD 943
            |.: .:|..:..||          .|....|.   |...:|..:.|.:|:     :::|..|..|
 Worm   706 NPVGNEPRAYRRGLMKSVVAKTSQPMSPQPRS---DSSGDLIGKAESENKLRRRYLHQKSTQLWD 767

  Fly   944 AEIRKLE-----RLLESGLTTTSTTTSS---STSLLTGGGHLKPELTVTSGISQTPAASKNR-TP 999
            . :.||.     |.|:.....:|.:.||   .||||.                :.|::|.|| ..
 Worm   768 L-VEKLRAQGDTRFLQQEWCLSSASPSSQERETSLLL----------------RQPSSSNNREET 815

  Fly  1000 SISGILPNLLLSVLPPVIPRASWP 1023
            |::...||...|        :.||
 Worm   816 SLTAAGPNGERS--------SDWP 831

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 122/451 (27%)
ANF_receptor 174..568 CDD:279440 110/412 (27%)
7tm_3 633..889 CDD:278433 105/257 (41%)
gbb-2NP_500579.3 PBP1_GABAb_receptor 50..395 CDD:107361 111/418 (27%)
7tmC_GABA-B-R2 439..705 CDD:320421 109/275 (40%)
TM helix 1 439..464 CDD:320421 9/25 (36%)
TM helix 2 476..497 CDD:320421 10/21 (48%)
TM helix 3 513..537 CDD:320421 11/24 (46%)
TM helix 4 556..576 CDD:320421 6/20 (30%)
TM helix 5 609..635 CDD:320421 12/26 (46%)
TM helix 6 644..667 CDD:320421 10/23 (43%)
TM helix 7 674..699 CDD:320421 10/25 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D267884at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10519
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.