DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and gbb-1

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:NP_741740.3 Gene:gbb-1 WormBaseID:WBGene00021528 Length:899 Species:Caenorhabditis elegans

Alignment Length:905 Identity:237/906 (26%)
Similarity:401/906 (44%) Gaps:141/906 (16%)


  Fly   157 GLFELSTSRGPRPDGLSELGAATMAVEHIN-RKRLLPGYTLELVTNDTQCDPGVGVDRFFHAIYT 220
            |.|.:.:..|....|.:.|.|..||::.:| |..:||||.|.:..:::||.||:.:.:.:..:| 
 Worm    28 GTFPMESGSGGWAGGEACLPAVEMALKDVNSRLDILPGYVLNMTNHNSQCQPGLAMQQLYDFLY- 91

  Fly   221 QPSTRMVMLLGSACSEVTESLAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSSHNPAR 285
            :|.|::::|.|  ||.||..:|:..|.|.:|.:|:|.:|||||:|..||..:||....:..||.|
 Worm    92 KPPTKLMLLTG--CSPVTTVIAEAAPVWKLVVLSYGGSSPALSNRNRFPTLFRTHPSANMQNPTR 154

  Fly   286 IAFIRKFGWGTVTTFSQNEEVHSLAVNNLVTELEAANISCAATITFAATDFKEQLLLLRETDTRI 350
            |..:.||.|...|.....|||......:|........|.......:.  |..:.:..|:..|.||
 Worm   155 IHIMEKFKWKRFTILMSVEEVFVTTAKDLEAIARKKGIKVDRQSFYG--DPTDAMKTLQRQDARI 217

  Fly   351 IIGSFSQELAPQILCEAYRLRMFGADYAWILHESMGAPWW---PDQRTACSNHELQLAVENLIVV 412
            |:|.|....|.::||:||...::|..|.|.........|:   |::...|:..::..|.|...  
 Worm   218 IVGLFYVTEARKVLCQAYHHGLYGRRYVWFFIGWYADTWYIPPPEEHLNCTAEQMTEAAEYHF-- 280

  Fly   413 STHNSIVGNNVSYSGLNNHMFNSQLRKQSAQFHGQDGFGSGYGSRISIAATQSDSRRRRRRGVGG 477
             |..|::.:..:...: :.|...|.:::..|:..:|                       ...|||
 Worm   281 -TTESVMLSRDNIPAI-SEMTGMQFQQRLTQYFQKD-----------------------TANVGG 320

  Fly   478 TSGGHLFPEAISQYAPQTYDAVWAIALALRAAEEHWRRNEEQS--KLDGFDYTRSDMAWEFLQQM 540
                  |||     ||..||||||:|||....     ||...|  :|:.|.|....:|....|.:
 Worm   321 ------FPE-----APLAYDAVWALALAFNCT-----RNNLPSHIRLENFTYDNKVIADTLFQCV 369

  Fly   541 GKLHFLGVSGPVSFS-GPDRVGTTAFYQIQRGLLEPVALYYPATDALDFRCPRCRPVKWHSGQ-V 603
            ....|.||||.|.|| ..||:..|...|:|.|..:.:..|...:..|::    ....:|.:|: .
 Worm   370 KNTSFRGVSGKVMFSDSGDRIARTQIEQMQGGKYKIMGYYDTTSGDLEW----YNKEQWLNGKGP 430

  Fly   604 PIAKRVFKLRVATIAPLAFYTIATLSSVGIALAIAFLAFNLHFRKLKAIKLSSPKLSNITAVGCI 668
            |....|.|....|::...:|.....:.:|||..:....|.....:...|..|.|:.:||..:||.
 Worm   431 PPDSTVIKKHAMTVSNEFYYPTILFAVLGIAACVFIYLFTQKHHERLIIFQSQPECNNILLIGCS 495

  Fly   669 FVYATVILLGLDHSTLPSAEDSFATVCTARVYLLSAGFSLAFGSMFAKTYRVHR----------- 722
            ....::.|:||....:..:|..|..:|.|||.:|..||:.|:||||||.:.|||           
 Worm   496 LCLFSLFLIGLPSDDISISESLFPLLCHARVTILLFGFTFAYGSMFAKVWIVHRMGATENQQLAS 560

  Fly   723 -----------------IFTRTG--------------------SVFKDKMLQDIQLILLVGGLLL 750
                             |.|..|                    :...::.:...:..::|..|..
 Worm   561 RQKDEEENTPWEGIRTLISTMVGRQALMRKSSGQAYGALLEKRNTVLNQPISSSKFYVIVAALTA 625

  Fly   751 VDALLVTLWVVTDPM---ERHLHNLTLEISATDRSVVYQPQVEVCRSQHTQTWLSVLYAYKGLLL 812
            ||..:..:||:.||:   |:.....|...|..|..::  |.::.|:|...:.|:.::..:|.|||
 Worm   626 VDVFVCFVWVLIDPLHLTEQKFPLFTPADSEEDEMIM--PVLQQCQSNQQEVWIGIIMGFKCLLL 688

  Fly   813 VVGVYMAWETRHVKIPALNDSQYIGVSVYSV-VITSAIVVVLANLISERV--TLAFITITALILT 874
            |.|.::::|||::|:..:|||:::|:::|:| |:|.....|:..||..:|  ..|||::|.||.|
 Worm   689 VFGTFLSYETRNLKLRFINDSRFVGLAIYNVAVMTLVTAPVVTLLIHGKVDANFAFISLTVLICT 753

  Fly   875 STTATLC-------LLFIPKLHDIWARNDIIDPVIHSM-------GLKMECNTRRFVVDDR---- 921
            ..:..|.       ::.:|...|....|..:.|.:.|.       .||.|..|.:..::::    
 Worm   754 YISVGLIYGPKIRHIIKVPPSADEIQLNGNVGPGVMSKVDQKRYDMLKKENETLQIQIEEKERKI 818

  Fly   922 RELQYRVEVQNRVYKKEIQALDAEI--RKLERLLESGLT-TTSTTTSSSTSL--LTGGGH 976
            .|.:.|:|...:  ..|.:.::|::  ...:::.:..|| :|:||.:::..|  |..|.|
 Worm   819 HECKERLEELTK--NSETEDMNAQLLCENDKQIADENLTYSTATTLTTTIPLIDLQNGNH 876

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 125/440 (28%)
ANF_receptor 174..568 CDD:279440 117/401 (29%)
7tm_3 633..889 CDD:278433 82/317 (26%)
gbb-1NP_741740.3 PBP1_GABAb_receptor 25..414 CDD:107361 124/434 (29%)
7tmC_GABA-B-R1 447..770 CDD:320418 83/325 (26%)
TM helix 1 447..472 CDD:320418 5/25 (20%)
TM helix 2 484..505 CDD:320418 6/21 (29%)
TM helix 3 523..547 CDD:320418 13/24 (54%)
TM helix 4 616..636 CDD:320418 6/20 (30%)
TM helix 5 673..699 CDD:320418 9/26 (35%)
TM helix 6 708..731 CDD:320418 8/23 (35%)
TM helix 7 739..764 CDD:320418 8/25 (32%)
PRKG1_interact 793..>848 CDD:318172 9/57 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3553
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D267884at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.