DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and gpr156

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:XP_005167483.1 Gene:gpr156 ZFINID:ZDB-GENE-060201-2 Length:800 Species:Danio rerio

Alignment Length:550 Identity:141/550 (26%)
Similarity:232/550 (42%) Gaps:130/550 (24%)


  Fly   530 SDMAWEFLQQMGKLHFLGVSGPVSFSGPDRVGTTAFYQIQRGLLEPVALYYPATDALDFRCPRCR 594
            |..||:.||::..|                  |.:...:|...|.|.                .|
Zfish    24 SQQAWDVLQRLCAL------------------TASSVDVQSRSLSPA----------------LR 54

  Fly   595 PVKWHSGQVPIAKRVFKLRVATIAPLAFYTIATLSSVGIALAIAFLAFNLHFRKLKAIKLSSPKL 659
            .|.|                            ||.|.||.||:.||.|.|.|:..:.:|:|||.|
Zfish    55 AVVW----------------------------TLLSCGILLALFFLIFTLRFKNNRIVKMSSPNL 91

  Fly   660 SNITAVGCIFVYATVILLGLDHSTLPSAEDSFATVCTARVYLLSAGFSLAFGSMFAKTYRVHRIF 724
            :.:|..|.:..|::..|..::..:|.|...:.| |..||::.|..|.||.||.:..||:|::|:|
Zfish    92 NVLTLCGSVLTYSSGFLFAIEEKSLLSGAGARA-VLQARMWTLCIGSSLVFGPILGKTWRLYRVF 155

  Fly   725 TRTGSVFKDK--MLQDIQLILLVGGLLLVDALLVTLWVVTDPMERHLHNLTLEISATDRSVVYQ- 786
            |:.   ..||  :::||||:.||..|:|||.:::|.|.:.|| .:...:::..:...|....|. 
Zfish   156 TQR---VPDKRVIIRDIQLMGLVALLVLVDIVVLTAWGLMDP-AKCSRSVSAMVKVIDLDSSYSL 216

  Fly   787 PQVEVCRSQHTQTWLSVLYAYKGLLLVVGVYMAWETRHVKIPALNDSQYIGVSVYSVVITSAIVV 851
            .|::.|.|.::..|:.::...||.||:.|.|:|..|.:|.:|.:|.|:.|..:|..|.::||:.|
Zfish   217 SQLDSCSSLYSHLWIILISVLKGSLLLYGTYLAGLTSNVSLPPVNQSKTIMGAVCLVTMSSAVAV 281

  Fly   852 VLANLISERVTLAFITITALILTSTTATLCLLFIPKL---------------------------- 888
            .::..:.....:.:..|:..|...|.|..||||:|:|                            
Zfish   282 PISLYLYSWPNVVYSVISGAIFICTMAINCLLFVPQLTQWRHFEEETNSHPSQMAKYFSSPSKTT 346

  Fly   889 HDIWARNDIIDPVIHSMGLKMECNTRRFVVDDRRELQYRVEVQNRVYKKEIQALDAEIRKLERLL 953
            :.:::.::|...:..:..:|...|.:..|:|   .||.:|   |....|.::.:.|     .:||
Zfish   347 NSMYSEDEIYYLLGENDSMKRLINEKNAVID---SLQEQV---NNAKDKLLKLMTA-----SQLL 400

  Fly   954 ESGLTTTSTTTSSSTSLLTGGGHLKPELTVTSGISQTPAASKNRTPSISGILPNLLLS----VLP 1014
            :.....:|.|..:|||..|         ||.|..|.|....:     .|.:.|..:||    |.|
Zfish   401 DEREMDSSNTNLNSTSTQT---------TVVSPDSPTLVLKQ-----YSEVAPTRVLSPPPYVPP 451

  Fly  1015 PVIPRASWPSAEYMQIPMRRSVTFASQPQL 1044
            |.||..:..:|...:.|   ..|..|.|.|
Zfish   452 PPIPIHTTSNATSPEGP---GATDESSPHL 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 10/60 (17%)
ANF_receptor 174..568 CDD:279440 7/38 (18%)
7tm_3 633..889 CDD:278433 85/287 (30%)
gpr156XP_005167483.1 7tm_3 65..318 CDD:278433 84/258 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10519
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.