DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and gpr156

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:XP_004919836.1 Gene:gpr156 XenbaseID:XB-GENE-962217 Length:792 Species:Xenopus tropicalis

Alignment Length:660 Identity:148/661 (22%)
Similarity:268/661 (41%) Gaps:113/661 (17%)


  Fly   628 LSSVGIALAIAFLAFNLHFRKLKAIKLSSPKLSNITAVGCIFVYATVILLGLDHSTLPSAEDSFA 692
            |.|.|:.|.:.|..|.|.||..:.:|:|||.|:.:|.:|....|.:..|..:....:     |..
 Frog    54 LLSAGLLLTLFFFIFTLRFRSNRIVKMSSPNLNLVTLIGSALTYISAFLFVVQEPNI-----SME 113

  Fly   693 TVCTARVYLLSAGFSLAFGSMFAKTYRVHRIFTRTGSVFKDK--MLQDIQLILLVGGLLLVDALL 755
            |:...|:.||..|.:|.||.:..|::|:||:||..   ..||  :::|:.|:.||.|||..|.||
 Frog   114 TIFQVRISLLYLGVTLVFGPLLGKSWRLHRVFTHR---VPDKRVIIKDVTLLSLVAGLLFADTLL 175

  Fly   756 VTLWVVTDPMERHLHNLTLEISATDRSVVYQPQV-EVCRSQHTQTWLSVLYAYKGLLLVVGVYMA 819
            :.:||::||:. ...:.:..|.|..|..:|.... :.|.|:::..|..:|..:|..||:.|.|:|
 Frog   176 LLMWVLSDPVV-CARSASASIKAAARGTLYSVTTQDFCASKYSDLWTGLLVGFKAALLIYGGYLA 239

  Fly   820 WETRHVKIPALNDSQYIGVSVYSVVITSAIVVVLANLISERVTLAFITITALILTSTTATLCLLF 884
            ..|.::..|.:|.|..|.:....|:..:..|.::.:...:...|.:.|.:..||..|||..||:|
 Frog   240 GLTNNISSPPVNQSLAIMIGNGLVMAGTGAVFLVTHFFHDWSNLVYATTSGSILVCTTAINCLIF 304

  Fly   885 IPKLHDIWARNDIIDPVIHS-MGLKMECNTRRFVVDDRRELQYRVEVQNRVYKKEIQALDAEIRK 948
            ||:|  :.:|....:.|..: |.......::.|......|..|.:..:|...:|.:...:|.|..
 Frog   305 IPQL--LQSRQFEEEQVQSTQMSKYFSSPSKSFRSMYSEEQIYHLLGENTSMRKLLSEKNAIIES 367

  Fly   949 LERLLESGLTTTSTTTSSSTSLLTGGGHLKPELTVTSGISQTPAASKNRTPSISGILPNLLLSVL 1013
            |:..:.:..........|..|..|      .|:|..|.:|.:..|.::.      :.|..:.::.
 Frog   368 LQEQVSNAKEKLMKLIKSECSFET------IEVTSLSVLSASTLAIQHH------VAPEHMKTIE 420

  Fly  1014 PPVIPRASWPSAEYMQIPMRRSVTFASQPQLEEACLPAQDLINLRLAHQQATEAKTGLINRLRGI 1078
            .|:   .|..:|::..:...............:|....:|. |::.:.::..|.           
 Frog   421 EPL---DSVENADHEAVIKDTQEVDIKHDTKSDAFQSPKDQ-NIQESEEKPQEG----------- 470

  Fly  1079 FSRTTSSNKGSTASLADQKGLKAAFKSHMGLFTRLIPSSQTASCNAIYNNPNQDSIPSEASSHPN 1143
               :..:||.|..|::.|:.:..:             .|::.|...|.:..:... |.|||..  
 Frog   471 ---SQCTNKPSGCSVSKQEDMSTS-------------DSRSVSFADIVSKSHHQH-PGEASER-- 516

  Fly  1144 GNHLKPIHRGSLTKSGTH--LDHLTKDPNFLPIPTISG--GEQGDQTLGGKYVKLLETKVNFQLP 1204
                            ||  |:.|::..|::....:..  .|...:|..|.:....:.:.:..: 
 Frog   517 ----------------THDVLEQLSRKINYVSSEKLQEILQELSIETTCGHHSPKRQRRASHSV- 564

  Fly  1205 SNRRPSVVQQ----------PPSLRERVRG----------SPRFPHRILPPT-CSLSALAES--- 1245
             ||.|.:|..          .|.:..|.||          |..||:.:.|.| |.|:..|.:   
 Frog   565 -NRDPGLVPSEGFRKMCVSLSPYMMRRRRGPVYSQRNQHPSHHFPNALPPQTWCLLNKEARNRCN 628

  Fly  1246 ------EDRP 1249
                  ::||
 Frog   629 GVKTTRDERP 638

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361
ANF_receptor 174..568 CDD:279440
7tm_3 633..889 CDD:278433 80/259 (31%)
gpr156XP_004919836.1 7tm_3 71..308 CDD:278433 75/246 (30%)
VirE3 <311..398 CDD:284150 16/93 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.