DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and LOC100498444

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:XP_017946351.1 Gene:LOC100498444 ID: Length:1051 Species:Xenopus tropicalis

Alignment Length:917 Identity:180/918 (20%)
Similarity:313/918 (34%) Gaps:296/918 (32%)


  Fly   177 AATMAVEHINRK-RLLPGYTL--------ELVTNDTQ------CDPGVGVDRFFHAIYTQPSTRM 226
            |...||:.|||. .:||..||        ..|.|..|      ..||..|..:    ..:...|:
 Frog    90 AFIFAVDEINRNPAILPNVTLGYHIFDSCRNVNNAMQDVFSILSGPGETVPNY----SCREQHRV 150

  Fly   227 VMLLGSACSEVTESLAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSSHNPARIAFIRK 291
            ...:|...:|.:..:|:::..:...|:|:|:|.|.|||:|.:|.|:||:..|.:...|....:|.
 Frog   151 AGFIGDLFTETSLPIAQLLRPYGYSQISYGATDPLLSDKRFYPAFFRTLPNDQTQYQAIAKLLRH 215

  Fly   292 FGWGTVTTFSQNEEVHSLAVNNLVTELEAANISCAATITF--AATDFKEQLLL-----LRETDTR 349
            .||..|.....::::......:|...|....|....|::.  .....:::|..     ||:|.:|
 Frog   216 LGWNWVGIIRSDDDIGEQLSRDLSKVLGEYGICIEYTLSIPEEQNPRRDELYARLQGKLRQTTSR 280

  Fly   350 IIIGSFSQELAPQILCEAYRLRMFGADYAWILHESMGAPWWPDQRTACSNHELQLAVENLIVV-- 412
               |:        ::|.  |:.:|   |...|....|:                 .:|.:::|  
 Frog   281 ---GA--------VMCS--RVSLF---YMNSLTREEGS-----------------LLEKILIVPV 312

  Fly   413 -------STHNSIVGNNVSYSGLNNHMFNSQLRKQSAQFHG--------------QDGFGSGYGS 456
                   ||..|:   ...|:|.   :|..:..|...:.|.              :|.|.:.:..
 Frog   313 NWNYRPYSTARSL---RTLYNGT---LFFKRPSKNLPRLHRLLENLNRTKGDKMLEDIFATYFNC 371

  Fly   457 RISIAATQSDSRRRRRRGVGGTSGGHLFPEAISQ-----YAPQT-------YDAVWAIALALR-- 507
            ..|:....:..:......:|..||    .|.|:|     |...|       |.||:|:|.||.  
 Frog   372 LTSVPLRNTMIQTIYPLVLGNCSG----KEKITQLKRKGYNTVTFRTTYHVYKAVYAMAYALHHM 432

  Fly   508 ---------------------------------AAEEHWRRNEEQSKLDGFDYTRSDMAWEFLQQ 539
                                             ..|.:::.|.|.|.:           :..|||
 Frog   433 LLPRGPPHLHTGAHIHRERFRHFLTKVHFKDPTGEEIYFKENGEMSSV-----------YHLLQQ 486

  Fly   540 MG-------------------------------KLHFLGVSGPVSFSGPDRVGTTAFYQIQRGLL 573
            :.                               ..|..|..||..:.|   ||....:.:...: 
 Frog   487 INWANGTTELRHVGTFNSSAPEEEQLVIAHRGFMWHLDGSGGPGEYGG---VGEEGGHHVHPHI- 547

  Fly   574 EPVALYYPATDALDFRCP----------------------------------RCRPV---KWHSG 601
             |:.|..........|||                                  .|:|.   ||.:.
 Frog   548 -PLFLQQIPVSRCTPRCPPGQRKLPRRGQQHACCYDCVQCSEGMISNDTDREACQPCPEDKWPNQ 611

  Fly   602 Q----VPIAKRVFKLRVATIAPLAFYTIATLSSVGIALAIA-FLAFNLHFRKLKAIKLSSPKLSN 661
            :    :|.:......: :....|.|..::.|.|...|:.:. |:|    ||....:|.::.:|| 
 Frog   612 KKDQCLPRSSEFLSYQ-SDWKTLLFSIVSILLSGVTAIIVGIFVA----FRHSPIVKANNQRLS- 670

  Fly   662 ITAVG-------CIFVYATVILLGLD-HSTLPSAEDSFATVCTARVYLLSAGFSLAFGSMFAKTY 718
            ...:|       |:|::     ||.. |.|           |..|...:...||:...|:.|||.
 Frog   671 FLLLGSIMMSFLCVFLF-----LGRPLHVT-----------CMLRQTCMGIIFSVVVSSVLAKTI 719

  Fly   719 RVHRIF--TRTGSVFKDKMLQDIQLILLVGGLLLVDALLVTLWVVTDPMERHLHNLTLEISATDR 781
            .|..:|  ::.|:.:|..:...|...::|...||..::.:. |:...|....|          :|
 Frog   720 MVCIVFKASKPGNYWKKCVGAKIPNGVVVACSLLQVSISIA-WLSISPPFMEL----------NR 773

  Fly   782 SVVYQPQVEVCRSQHTQTWLSVLYAYKGLLLVVGVYMAWETRHVKIP-ALNDSQYIGVSVYSVVI 845
            |...:..:: |.......:.:|| .|.|||..|...:|:..|  |:| :.|:::||   .:|:::
 Frog   774 SFPGKILIQ-CNEGSPVAFYAVL-GYLGLLAAVSFIVAFLAR--KLPDSFNEAKYI---TFSMLV 831

  Fly   846 TSAIVV--VLANLISERVTLAFITITALILTSTTATLCLLFIPKLHDIWARNDIIDPVIHSMGLK 908
            ..::.|  :.|:|.........:.|.| |:.|:...|..:|.||.:.|.              :|
 Frog   832 FCSVWVSFIPAHLSVTGKNTVVVEIFA-IMASSFGVLASIFFPKCYIIL--------------IK 881

  Fly   909 MECNTRR 915
            .|.||:|
 Frog   882 PEQNTKR 888

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 100/536 (19%)
ANF_receptor 174..568 CDD:279440 97/514 (19%)
7tm_3 633..889 CDD:278433 63/270 (23%)
LOC100498444XP_017946351.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D590810at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.