DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and LOC100498137

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:XP_017948207.1 Gene:LOC100498137 ID: Length:453 Species:Xenopus tropicalis

Alignment Length:481 Identity:105/482 (22%)
Similarity:169/482 (35%) Gaps:111/482 (23%)


  Fly   172 LSELGAATMAVEHIN-RKRLLP----GY---------------TLELVTNDTQCDPGVGVDRFFH 216
            ::|......|||.|| ...|||    ||               ||.:::..||..|.....:   
 Frog     1 MAEHAGLIFAVEEINSNPELLPNISLGYEVFDTCYALRRAAQGTLSMLSGGTQSTPNYNCHQ--- 62

  Fly   217 AIYTQPSTRMVMLLGSACSEVTESLAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSSH 281
                  .|.:..::|.:.|..:..:|:::..:...|:|:.:|:|.||||..||.|:|||..|...
 Frog    63 ------GTHLAGVVGDSGSTQSILMAQILGLYQYPQISYFATNPVLSDRNLFPSFFRTVPSDEFQ 121

  Fly   282 NPARIAFIRKFGWGTVTTFSQNEEVHSLAVNNLVTELEAANISCAATITFAATDFKEQ------- 339
            .......:..|||..|...:.:.:.....:...:.|:    ||..|.:.|..|....|       
 Frog   122 MRGLAQLLSHFGWSWVGVLATDNDYGQYGLQIAMQEI----ISSGACVAFTETILTGQPNRNAPR 182

  Fly   340 -LLLLRETDTRIIIGSFSQELAPQILCEAYRLRMFGADYAWILHESMGAPWWPDQRTACSNHELQ 403
             ..:::|:..:::|..........:|.|..|..:.|.  .||..|.     |. ...:.||...|
 Frog   183 LAQVIKESTAKVVIAITGDSDLVIVLEELLRQNVTGK--IWIATEG-----WA-TANSLSNERFQ 239

  Fly   404 LAVENLIVVSTHNSIVGNNVSYSGLNN--HMFNSQLRKQSAQFHGQDGFGSGYGSRISIAATQSD 466
            ..:...|..:.::   |...|:|...|  |..|........:|..| .|...:.|:.:::...: 
 Frog   240 GILLGAIGFAIYS---GQMPSFSEYLNSLHPSNDLYDPFIKEFWEQ-AFSCKWPSQKNVSLVDN- 299

  Fly   467 SRRRRRRGVGGTSGGHLFPEAISQYAPQTYDAVWAIALALR--------AAEEHWRRNEEQSKLD 523
              .|.:...|......:..:...:.:...|.||:|||.||.        ....|          |
 Frog   300 --VREQTCTGNERLESVLTKVDRRVSGNVYTAVYAIAWALHNLLNCTAGVGPFH----------D 352

  Fly   524 GFDYTRSDM-AWEFLQQMGKLHFLGVSGPVSFSGPDRVGTTAFYQIQRGLLEPVALYYPATDALD 587
            |.....|.. .|..||.:.|         |:|..|  .|...|:. :||  .|.|:|       |
 Frog   353 GACANISSFHPWHLLQYIKK---------VNFKTP--AGNRVFFD-ERG--NPPAIY-------D 396

  Fly   588 FRCPRCRPVKWH------SGQVPIAK 607
            .       |.||      .||:.:.|
 Frog   397 I-------VNWHLTSQGSLGQITVGK 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 99/457 (22%)
ANF_receptor 174..568 CDD:279440 93/433 (21%)
7tm_3 633..889 CDD:278433
LOC100498137XP_017948207.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D590810at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.