DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABA-B-R3 and gabbr1

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:XP_012823396.1 Gene:gabbr1 XenbaseID:XB-GENE-956617 Length:987 Species:Xenopus tropicalis

Alignment Length:929 Identity:263/930 (28%)
Similarity:432/930 (46%) Gaps:121/930 (13%)


  Fly   108 PGSTNASHAHHLLNLPPRQRYLK-VNQVFESERRMSPAEMQRNHGKIVLLGLFELSTSRGPRPDG 171
            ||......:|.|.....:..:.| :.||...:..:...|..|... :.:..||.:|   |..|.|
 Frog   130 PGFLLVGSSHSLCTKSGKWDHPKPICQVRRPDTSIRHPESSRKRA-LHVGALFPMS---GGWPGG 190

  Fly   172 LSELGAATMAVEHINRKR-LLPGYTLELVTNDTQCDPGVGVDRFFHAIYTQPSTRMVMLLGSACS 235
            .:...||.||:|.:|.:| :||.|.|.|:.:|:|||||......:..:|..|...|:|   ..||
 Frog   191 QACQPAAQMALEDVNNRRDILPEYELRLIHHDSQCDPGQATRYLYELLYNDPIKIMLM---PGCS 252

  Fly   236 EVTESLAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSSHNPARIAFIRKFGWGTVTTF 300
            .|:..:|:....|:::.:|:||:|||||:|:.||.|:||....:.|||.|:...:|:||..:.|.
 Frog   253 SVSTLVAEAARMWHLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFKKWGWTKIATI 317

  Fly   301 SQNEEVHSLAVNNLVTELEAANISCAATITFAATDFKEQLL---LLRETDTRIIIGSFSQELAPQ 362
            .|..||.:..:::|...::.|.|.    |||..:.|.:..:   .|:..|.|:|:|.|.:..|.:
 Frog   318 QQTTEVFTSTLDDLEERVKEAGIE----ITFRQSFFSDPAIPVKNLKRQDARVIVGLFYETEARK 378

  Fly   363 ILCEAYRLRMFGADYAWILHESMGAPWW--PDQRTACSNHELQLAVENLIVVSTHNSIVGNNVSY 425
            :.||.|:.|:||..|.|.|.......|:  ||....|:..|:..|||..:   |...::.|..:.
 Frog   379 VFCEVYKERLFGKKYVWFLIGWYADNWFKIPDPAINCTVEEMTQAVEGHV---TTEIVMLNPENT 440

  Fly   426 SGLNNHMFNSQLRKQSAQFHGQDGFGSGYGSRISIAATQSDSRRRRRRGVGGTSGGHLFPEAISQ 490
            .|::|                             :.:.:...:.::|.|......|.|      |
 Frog   441 RGISN-----------------------------MTSQEFMEKLKKRLGENPEMTGGL------Q 470

  Fly   491 YAPQTYDAVWAIALALRAAEEHWRRNEEQSKLDGFDYTRSDMAWEFLQQMGKLHFLGVSGPVSF- 554
            .||..|||:||:||||.  :..:..:::..:|:.|:|....::.|..:.|....|.||||.|.| 
 Frog   471 EAPLAYDAIWALALALN--KTAYELSKKGRRLEDFNYNNKMISEEIYRAMNSSSFDGVSGHVVFD 533

  Fly   555 -SGPDRVGTTAFYQIQRGLLEPVALYYPATDALDFRCPRCRPVKWHSGQVPIAKRVFKLRVATIA 618
             || .|:..|...|:|.|:.:.:..|....|.|.:    ....||..|..|.......:....::
 Frog   534 ASG-SRMAWTLIEQLQGGVYKKIGYYDSTKDNLSW----YNNDKWIGGSPPADHTKVIITFRYVS 593

  Fly   619 PLAFYTIATLSSVGIALAIAFLAFNLHFRKLKAIKLSSPKLSNITAVGCIFVYATVILLGLDHST 683
            ...|.:::.|:.:||.|....|:||::...::.|:.|.|.|:::||.|||...|.|..||||...
 Frog   594 QKLFISVSVLAGLGILLGFVCLSFNIYNSHVRYIQNSQPHLNDVTAAGCILSLAAVFPLGLDGRH 658

  Fly   684 LPSAEDSFATVCTARVYLLSAGFSLAFGSMFAKTYRVHRIFTRTGSVFKD---------KMLQDI 739
            :.:..  |..||.||::||..|||||:||||.|.:.:|..||:     ||         :.|:..
 Frog   659 IETWH--FPLVCQARLWLLGLGFSLAYGSMFTKIWWIHTAFTK-----KDDKKERRKQSQTLEPW 716

  Fly   740 QLILLVGGLLLVDALLVTLWVVTDPMERHLHNLTLEISATDRSVVYQPQVEVCRSQHTQTWLSVL 804
            :|...|..||.:|.:.:.:|.:.||::|.:...|.|....|..|:..||:|.|.|....|||.::
 Frog   717 KLYTTVSLLLGLDVITLGIWQIVDPLQRSIEEFTKEEPRGDLDVLILPQLEHCSSLKMNTWLGIV 781

  Fly   805 YAYKGLLLVVGVYMAWETRHVKIPALNDSQYIGVSVYSVVITSAIVVVLANLISERVTLAFITIT 869
            |..|||||::|:::|:||:.|....:||.:.:|:::|:|.:...|...:..::|.:...:|...:
 Frog   782 YGSKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDASFAFSS 846

  Fly   870 ALILTSTTATLCLLFIPKLHDIWARNDIIDPVIHSMGLKMECNTRRFVVDDRRELQYRVEVQNRV 934
            ..|:.|...||.:||:||:..:..|.:.......::......|...             |.::|:
 Frog   847 LAIVFSAYITLVVLFVPKMRRLITRGEWQSEQQDTLKTGSSTNNNE-------------EEKSRL 898

  Fly   935 YKKEIQALDAEI-RKLERLLESGLTTTSTTTSSSTSLLTGGGHLKPELTVTSGISQTPA---ASK 995
            .::|.|.|...| .|.||::|                      |:.:|......| .||   .|.
 Frog   899 LERENQELGRIIAEKEERVME----------------------LRQQLRSRRRPS-VPARDNCSD 940

  Fly   996 NRTPSISGILPNLLLSVLP 1014
            |..|:.||.:.:|....||
 Frog   941 NHFPNSSGAVSSLYQPGLP 959

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 131/441 (30%)
ANF_receptor 174..568 CDD:279440 120/402 (30%)
7tm_3 633..889 CDD:278433 91/265 (34%)
gabbr1XP_012823396.1 CCP 104..156 CDD:153056 5/26 (19%)
PBP1_GABAb_receptor 176..569 CDD:107361 131/448 (29%)
ANF_receptor 192..548 CDD:279440 120/404 (30%)
7tm_3 608..865 CDD:278433 91/264 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D267884at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.