DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Eaat2 and slc1a5

Sequence 1:NP_001162844.1 Gene:Eaat2 FlyBaseID:FBgn0026438 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_001008127.1 Gene:slc1a5 XenbaseID:XB-GENE-482596 Length:527 Species:Xenopus tropicalis

Alignment Length:516 Identity:181/517 (35%)
Similarity:300/517 (58%) Gaps:35/517 (7%)


  Fly    20 PTSTELPP---KTTECSDAPVELTGYRRWLSENLMLLVTLSGVLLGVILGLSLRPLNLHGDSIML 81
            |....:||   ::.|.:.:|......||:|..|:::|:|:.||::|..||:::||||:....|..
 Frog    12 PGEHPVPPGLHRSGESASSPGCGPRCRRFLRGNVLVLLTVLGVIMGAGLGMAVRPLNMSKAHIAS 76

  Fly    82 ISYPGELFMRVLKLMILPLVISSLIAGSASLNAKMNGKIALRTLVYFASTSFFNAALGIALVLLI 146
            .|:||||.:|:||::|||||:.||::|:|||.....||:....:::|..|:...:.||:.|.|||
 Frog    77 FSFPGELLLRLLKMIILPLVVCSLVSGAASLQPSALGKLGGWAMLFFLITTLLASGLGVCLALLI 141

  Fly   147 HPGNPDLHNADDRSTDRRAVNLLDSLLDLGRNVFPDNLFQASIQQAHTVYLPKPSILHV-FNETM 210
            .||..................::||.|||.||:||.||..|:.|...|.|  |..:::. .|..|
 Frog   142 RPGVGAQVALGQGGGIPEGKEVVDSFLDLIRNIFPSNLVSAAFQSYATSY--KLELVNTSANGEM 204

  Fly   211 NDT---LASGSEAQRLSEDLTEDVVLVRDIQYRSGTNTLGIVFFCLVFGTFLGTIGQKGQVVVDF 272
            |:|   :..|.|.:                    |.|.||:|.|.:|||..|..:|.:|::::.|
 Frog   205 NNTWVKVPYGQEVE--------------------GMNILGLVVFAIVFGIALRKLGPEGEILIRF 249

  Fly   273 FAAIFEVIMKMVTCVMWLTPVGISSVIAGKILSVGDLGLVMSQLMWFIVTVAIGVFIYQFVVMQA 337
            |.:..|..|.:||.:||..|:||..::||||:.:.|:..:.:.|..:|....:|..|:..:|:..
 Frog   250 FNSFNEATMVLVTWIMWYAPLGIMFLVAGKIVEMEDVVQLFTSLGKYISCCIVGHIIHGLLVLPL 314

  Fly   338 IYFVVVRRNPFKFYAGLIQAMLTAFATASTAAALPITFRCMNEKLKVDPRITRFVLPIGCNINMD 402
            |||...|:||::|..|::.|:.|||.|:|::|.||:..:|:.|:..|..:|:||:||||..:|||
 Frog   315 IYFAFTRKNPYRFLWGIVSALATAFGTSSSSATLPLMMKCVEERNGVSKQISRFILPIGATVNMD 379

  Fly   403 GTALYIAVASIFIAQMSGMVLGFGELLTVLLTSTAASMSSASVPSAALVLLLVVLTAIDAPVQDV 467
            |.||:..||::||||::.:.|.|.:::|:|:|:||:|:.:|.:|:..::.|.::|.|:..|..|:
 Frog   380 GAALFQCVAAVFIAQLNNVSLDFIQIITILVTATASSVGAAGIPAGGVLTLAIILEAVSLPTNDI 444

  Fly   468 TLLFAVDWFVDRIRTTNNMLGDCYTAAVVEELSRKELMA---LDAASVNYQ---DMPAGTP 522
            :|:.||||.|||..|..|:.||.:.|.:::..|.:...:   .:.|:|..:   |.|.|.|
 Frog   445 SLILAVDWLVDRTCTVLNVEGDAFGAGLLQVYSDRTASSSEGTELAAVQVEIPGDHPEGDP 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Eaat2NP_001162844.1 SDF 51..496 CDD:278787 165/449 (37%)
slc1a5NP_001008127.1 SDF 55..473 CDD:306807 161/440 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1184392at2759
OrthoFinder 1 1.000 FOG0000116
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.