DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Eaat2 and Slc1a5

Sequence 1:NP_001162844.1 Gene:Eaat2 FlyBaseID:FBgn0026438 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_786934.1 Gene:Slc1a5 RGDID:708512 Length:539 Species:Rattus norvegicus

Alignment Length:505 Identity:170/506 (34%)
Similarity:286/506 (57%) Gaps:59/506 (12%)


  Fly    44 RWLSENLMLLVTLSGVLLGVILGLSLRPLN----LHGDSIMLISYPGELFMRVLKLMILPLVISS 104
            |.|..||::|:|::..:.||:|||.:....    |........::||||.:|:|:::|||||:.|
  Rat    48 RCLRANLLVLLTVAAAVAGVVLGLGVSAAGGAEALGHARFTAFAFPGELLLRLLEMIILPLVVCS 112

  Fly   105 LIAGSASLNAKMNGKIALRTLVYFASTSFFNAALGIALVLLIHPG-----------NPDLHNADD 158
            ||.|:|||:....|::....|::|..|:..::|||:||.|.:.||           :..:|.|..
  Rat   113 LIGGAASLDPSALGRLGAWALLFFLVTTLLSSALGVALALALKPGAAFAAINSSVVDSSVHRAPT 177

  Fly   159 RSTDRRAVNLLDSLLDLGRNVFPDNLFQASIQQAHTVYLPKPSILHVFNETMNDTLASGSEAQRL 223
            :       .:|||.|:|.||:||.||..||.               .|.      :..|:..||.
  Rat   178 K-------EVLDSFLELLRNMFPSNLVSASA---------------AFR------IPCGACPQRS 214

  Fly   224 SEDLTEDVVLVRDIQYRSGTNTLGIVFFCLVFGTFLGTIGQKGQVVVDFFAAIFEVIMKMVTCVM 288
            :..:.:....::       .|.||:|.|.:|||..|..:|.:|::::.||.:..:..|.:|:.:|
  Rat   215 NATMDQPHCEMK-------MNILGLVVFAIVFGVALRKLGPEGELLIRFFNSFNDATMVLVSWIM 272

  Fly   289 WLTPVGISSVIAGKILSVGDLGLVMSQLMWFIVTVAIGVFIYQFVVMQAIYFVVVRRNPFKFYAG 353
            |..|:||..::||||:.:.|:..:...|..:||...:|..|:..:|:..|||:..|:||::|..|
  Rat   273 WYAPIGILFLVAGKIVEMKDIRQLFIGLGKYIVCCLLGHAIHGLLVLPLIYFLFTRKNPYRFLWG 337

  Fly   354 LIQAMLTAFATASTAAALPITFRCMNEKLKVDPRITRFVLPIGCNINMDGTALYIAVASIFIAQM 418
            ::..:.|||.|:|::|.||:..:|:.||..|...|:||:||||..:||||.||:..||::||||:
  Rat   338 IVTPLATAFGTSSSSATLPLMMKCVEEKNGVAKHISRFILPIGATVNMDGAALFQCVAAVFIAQL 402

  Fly   419 SGMVLGFGELLTVLLTSTAASMSSASVPSAALVLLLVVLTAIDAPVQDVTLLFAVDWFVDRIRTT 483
            :||.|.|.:::|:|:|:||:|:.:|.:|:..::.|.::|.||..||:|::|:.||||.|||..|.
  Rat   403 NGMSLDFVKIITILVTATASSVGAAGIPAGGVLTLAIILEAISLPVKDISLILAVDWLVDRSCTV 467

  Fly   484 NNMLGDCYTAAVVEEL--------SRKELMALDAASVNYQDMPAGTPNGH 525
            .|:.||.:.|.:::..        |..||:.: ...|:.:.:|..|..|:
  Rat   468 LNVEGDAFGAGLLQSYVDRTKMPSSEPELIQV-KNDVSLKPLPLATEEGN 516

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Eaat2NP_001162844.1 SDF 51..496 CDD:278787 159/460 (35%)
Slc1a5NP_786934.1 SDF 87..480 CDD:278787 151/428 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1184392at2759
OrthoFinder 1 1.000 FOG0000116
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126739
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.