DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gsc and YHP1

Sequence 1:NP_001137762.2 Gene:Gsc FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_010739.3 Gene:YHP1 SGDID:S000002859 Length:353 Species:Saccharomyces cerevisiae

Alignment Length:129 Identity:31/130 (24%)
Similarity:55/130 (42%) Gaps:35/130 (27%)


  Fly   339 RKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKREEQ 403
            |::|.||  :..:|..|:..||:...|:...|.:|:.:.::.|:.|::||:|:|...:|.|    
Yeast   174 RRKRRRT--SSYELGILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAKKHK---- 232

  Fly   404 ERLRKLQEEQCGSTTNGTTNSSSGTTSST---GNGSLTVKCPGSDHYSAQLVHIKSDPNGYSDA 464
                                 :||.||..   .|.|:::     ..||...:.|.|.|....:|
Yeast   233 ---------------------NSGNTSHCKVHSNDSMSM-----ISYSDAALEITSTPTSTKEA 270

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 15/53 (28%)
YHP1NP_010739.3 COG5576 123..278 CDD:227863 31/130 (24%)
Homeobox 181..232 CDD:278475 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6207
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.